ELFP4( U ]U@]U@]U]U]U@ ]UExT%]UExT%]UUE $R\US]E 9u[]UE D$E$P8UE D$E$P9~㻀뙁Ĝ[^_]UE D$E$UVSM] A|t$ډƉp*)fx@t$$xTt$xUt$[^]US{x &N)‰F ǀ@ǀǀǀ D$$`D$$B B`0~ǀǀ@tCt@u[]UWVSExutzt Njٍ )9~8L$$0R,`ٍ )9ȋED$ D$E $ )))ƒ~/ D$D$$ED$E $R,@=@t#UT$T$ D$ D$E $[^_]UWVSE}܅t|$E $|$U $á+~ ǀ `y ǀ ~ ~ ~~9fDt/f;t&fDždhd$|$E $`BBft^E 4G6؉\fZf9}fK;\} ZfCfS9u̍4`zut|$E $S )‰S ;tI|$U $} C5FN)Ӄ?ʃ?)ȉFxDtO} ~hO@)B=~fO=}fOfO9M t!뼉|$ |$@D$E $|$|$ D$D$U $d\$D$$|$D$ D$tD$D$ D$D$E $D$U D$$|$E $P(xtD$|$U $E `)Љut$`D$$0 ))ÍC~`D$D$$t$$0P$B|@D$$xuuB9W&|$U $P$E B|D$$ļ[^_]USU] ED$\$$t ED$\$$[]ÐUED$$RdUU T$UT$$PlU8EE E܉$B$B(B,BXUWS@]уEE@Eԉ$\$$8B$B(B,BXD$ $<u<@$@(@,@Xƀ@[_]UuGt3D$$uƀ$ƀUWVS<}z( ?o $ @D@$@(@,@X@L@P@Uf@B @D@$@(@Xf@B@ B,@X# @DEE E$@$@(@,@XD$D$ B0D$B4D$G$u@$ @,m @DEE E$@,@X?eu1D$@\D$ D$D$G$/D$D$ B0D$B4D$G$@$@( @DEE E$@,@X?ou1D$@\D$ D$D$G$'D$ B0D$B4D$G$@$@( O9EbGEE$fǀDž Dž $Kfǀh O9&D$@@\$! @DEEE$@$@(@,@XB\D$D$ D$BD$G$@$@,@X`@DEE E$@$@(@,@X@@@AD$B0D$B4D$ G D$GD$G$@$@,@XBDEE E$G$%G$?"u G$@$@(@,@X@@@ABD$D$B0D$B4D$ G D$GD$G$EJEG E]$EGE$EG E$EG$E$EG,E$EG0E$@$G t-D$ GD$G$D$G$@(@,@XB$@(@,@X@@@AG$ƒ%G$xpx$^x,Q@DEE ]$@(@X@@@ABD$D$B0D$B4D$ G D$GD$G$EJEG E$EGE$EG E$EG$E$EG,E$EG0E$@$@,@XB@@A@,@DEE@E$@$@(@X@\D$ G D$GD$G$@$sGD$GD$GD$GD$ G D$GD$G$4EE@E$@,@X@\D$$G$D$ GD$G D$GD$GD$G D$ GD$GD$G$@,EE@E$@,@X@\D$GD$G D$ GD$GD$G$@,$BDEE@E$@$@X@(@,@\D$DGDD$@G@D$wiu+gѺ̉(ȃ0F9u>i(щʃ0S9tڿ 8}48uE[^_]UWVSuEu[v}vpvcvVvIw<5ǍHu5f8< v70tٸǍHU ȉ[^_]ÐUVSUv_к ~ i*0iUUi}E)Ӄ[^]U $t$|$Ef=oi U|N)iɹXЉi*Љ˹)Ћ$t$|$]ÐU $t$|$]u }׋EfЋUfBfJfB$t$|$]UWS] }MEEfEUȋUfBËEfXE U؋UfB[_]U $t$|$]u }EffWfOfG$t$|$]UWS] }ME)EfEU)ȋUfB)ËEfXE U)؋UfB[_]U $t$|$]u }+EffWfOfG$t$|$]UWVSu;u~uED$|$4$}t9uu UDF%É؃,[^_]ÐUWVS\EEU fU}MfMEfE}tfUEEf~4uEEUEEf9uf9}~/NjMf}u]EfEf;]u}x}y }~@U EЉUǍ4EU)EEfE9EE EMMEfE}E9E}E+EfEȋUUMME)E}tUE)EE9Ew}tf}f}tU9Uff EEȃ\[^_]UWVSL}U EMfMt4ڋMY)UĉL$$EED$$=v* EЉUfEEU9UE E֋]MfEE9]s+EfEȉ]ffҘ)Ӊt ffҘ)9Mwtf}f}t M9Mf EEȃL[^_]ÐUWVS E u}FU}utUfyغX!f~fعf=~Ã҈9uEfy Ef=~f=#¹҃fu f EكЃՈ9ut| [^_]UWVSE }}uKƋUfƒT!f!fftf9tvEEEM]fЉfӃLƃt؉N! fftfEE+E9Et뜃[^_]ÐUWVSDžEu"DžUt+}~!9}u]l]DžDM 4f4f3tftfs4f+4fsTDf+TfS~f;f{f{f{9lvʉ}ff9luу;Dž≕}M Dž+hUf2]LZߋUf|f$ǀDǀԋǀ؋̋t$Ћy$wqɋt$Ћt$JDˋt$Ћ@t$@@ʋvЋ ty$ ЋyǂȚǀԋ u$ ǀڛǀԋz͋t\uXҋtOu ԋЋ u 74ԋ+=_T~!ԋK~ t&UԋЋym̋t$i t$$ t&ǀ<@$ǀ  tDʋt$ I$ ǀ<tDɋt$$ǀt>ʋt$e$ǀH@t>ˋt$@@q"$@ǀ3ǀԋUԋG(ȋ6ǀJ܋ԋԋ̋t)Ћy $ǀɋt$Ћt$ˋt!Ћ@t$@@d}ʋttЋ th$ ܋ ǀȚ?Ћ u *$ ǀڛǀԋUˋt)$@$@ǀԋ~Uʋt)$$ǀFԋ~:Ћ@t$@ǀ3ǀԋUɋt)$$ǀkԋ_T~_Ћt$ǀ&@t$@ǀ3ǀԋŰt,$$ǀԋ_TЋt$ǀJt$ǀ&@t$@ǀ3ǀԋUfǀƀ]UVS] E4C\$D$$09u[^]UWVS }] 4{t!\$D$$09t!߉\$D$$09uff ~fǀ [^_]ÐU8EE܍E܉$UE8_u UVS@]u U M҉T$\$4$\$4$E$E$EE Eԉ$@[^]ÐUU]U0ǀ0ǀa]Uǀǀ]UWVSD$E D$ ЎD$̎T$E$(t$D$D$D$D$ D$D$@M $Ét$$ )‰܍D$ t$ԎT$$5܍+~ ̍$č ! +$ ~7ڍtDȍǀЍƀٍ$u 9 )É؀t))9~) 9}ٍu$(~Ɓٍ ؍t#ǀЍƀٍ3Ѝ=Ѝ č9~)ǀ̍ ;ȍ+č̍܎؎܎܎uNَ0؎؍t؎D$$ǀ܎ƀ؎91D$MD$$܍D$D$%$؍u;;|w9~lƂ؍$$؍tJ9~~69}+ԍ~Ƃ؍$%ԍ ǂԍ[^_]UVS]u UڍD$D$$܍D$D$$<ƀَ@tgЎǀǀǀǀuRЎǀǀǀǀXЎǀǀ ǀ`ǀǀ$ t ǀǀAǀǀǀƀَuЎw ЎdǀǀǀǀuЎЎǀǀ Au]tAččč-ȍǀ̍ƀٍfǀ̎fǀΎǀԎǀǀ܎ƀ؎ƀ؍ǀǀ0ǀaǀԍ[^]ÐUWVS u]E 8EE$)%=~-9]tЋE  [^_]U]u}u} 4\$ ED$|$4$ED$ \$ED$4$D$D$<$]u}]ÐUU]UWVS}fAy0{E9}~t"\$ D$D$4$ \$ D$D$4$)fst"\$ D$D$ $ \$ D$D$ $)ƍC)fРu#D$$ƀ;]yu7D$$ƀf04{9t"\$ D$D$<$ \$ D$D$<$f)fРft)\$ D$D$$'\$ D$D$$РC9yE D$D$T$ D$D$ <$D$xD$$ [^_]UVS]u D$D$$P@tYfǀ $ǀ@uDǀfǀ`ǀ@fǀF$ tEǀ]tAfǀAffǀu6ǀ@Dǀ`vfǀu3ǀ1ǀ fǀfǀƀ[^]ÐUWVSUuu ƀ4T$ t$t$<$Lt;uƀD$$juƀD$$kuƀD$$m$ $ ǀǀܔǀUؔ)~ǀUtY~Nܔ~4ǀǀܔǀ ǀܔY~aU~v$$D$$=ǀǀܔǀ ǀܔ~Utp'~eD$$:$ $ ǀW ǀܔǀ ǀܔ~Uܔ+~kD$$ ǀܔ;~-tD$$ǀ tyƀ $ǀƀD$$j$ǀǀؔ;u2ǀ$ǀܔǀU'$ $ ǀǀܔǀt D$$AƀD$$jD$$= ǀܔ~ÐUؔ)~$ǀUtW~MD$$7ǀ ǀܔǀ ǂUu  ǀ~Gt ƀ t ƀ ǀǀܔU$$ǀ ǀܔǀ$$ tD$$AD$$?Ut  ǀܔW$$ǀܔ t3ǀ$$ǀ G~3D$$5$$o Uܔ+~kD$$ ǀܔ;~-tD$$ǀ t3ƀ $uD$$@Uuǀ $UD$$3ǀ[ǀǀܔUܔ_ ~ $t  ǀ~5D$$6$$fܔW~fÐUkEU(ff)fy fǀtСƀQƀRƀSƀTƀUƀXUSkEU耉$tСh[]UEй@uV uLuBu8%@߉=@t'ψ@uuЃ Ƀ]UEй @uR uH u> u4%@ =@t#@uuЃ у]Uƀ[ƀ\ƀ]ƀƀƀƀ]Uƀ[ƀ\ƀ]\\\\]US_u@fǀ fǀ@tf y ftf@t ft ft f t f@$[]UU]U(~$ǀTt.Pt%pp~ǀ  ǂpU]u}(~$ǀTtpQp~~([+lVƹʉ)@uiʀ>ų )‰T$$ $ǀTu ǀp]u}]UD$$jD$$kD$$mƀƀE$ǀǀǀ(ǀ$U`uƀ`D$$jbuƀbD$$m$ $ƀƀǀtǀxƀXƀYǀǀǀpǀ(ǀ$U$~hǀ$ǀ$ǀhǀ(ǀ$ǀU]uu ]ct$$t$$ u翉t$$ u߉t$$ ut$$ ut$$ u㿉t$$u&!牉t$$u Ë]u]Uǀ(ǀ$ǀpǀhƀPƀQƀRƀSƀTƀUƀVƀWƀXƀYƀcƀdƀeƀf`tƀ`D$$j@D$|$$$$ƀƀǀǀ$$@ƀYƀZ$ƀƀyZtgƀT$D$$,ƀt&ǀǀyeD$D$$ǀ,|ucǀ$$ǀǀ$ǀ,`ǀǀǀc$lt&ǀǀtǀ ǀh9tǀ ǀhǀ ǀh$$ǀǀp|u,$33ǀǀ;$$ǀǀUE$US]U|U U@D$\$$<CtƀZ ƀZC@tƀ_ ƀ_C t _tCt ƀ[ ƀ[C!tƀ\ ƀ\C!tƀ] ƀ]C!tƀ^ ƀ^ƀ`ƀaƀb[]ÐU$~7ǀǀǀpǀ(]U0@9(|(ǂaǀ(ǀp]UPt$$ǀ(]~ $"UP(]~$"TtTpp~g$ǀpǀǀ('ǂp$%ǀZU(%~ $Tt ǀppSu p6$$mǀǀ!U]u}(%~ $Qi Mb )Ǹf0@u f0t$$0$ 0iVUff)f0ǀǀ(]u}]U$~%ǀ$ǀ#$U$~%ǀ$ǀ~%Uƀƀǀ$ǀ"ǀ$U$~uǀ$$ƀ]ƀ\\ǀ!ǀ$U$~*$ǀ!ǀ$U$~9$ǀ#ǀ$ǀ(U$ǀ$$ǀ"ǀ$ǀ$ǀ(ǀpU$~sǀ$$$$ǀ$ǀA!ǀ$U$ ~[ƀ[\\^$ǀ-U(ǀ$ƀ[fǀtǀp\\$ǀ)ǀ(U$~%ǀp$ǀ&US$F092$X)‰T$$$)É\$$ VUUU)‰8ǀ8D$D$$ƀ]$fǀtǀp\\ƀ\ǀ@%[]US$o~XLǀ$$ǀ_'ǀ$[]U0@9$Ƃ]ƀƀƀ\ǀǀǀ (ǀǀpǀ(U(%~$Ttopp~e$ǀ(ǀ$ǀpǀ( ǂpUS(%~ $Q4ǀ44ǀ<ɡ<;8|ც<<`$lٺVUUU)R$ǀ$ǀ([]U(ǀ$]$]$$^DD$X)‰T$$ǀ*U(~_ƀ^ǀ$ǀ +ƀVUS(J~ $VY(ID$$ f`v<ӪLHH$i~ D$$vu ƃ[$f#fƀ[ƀƀ$ǀpǀǀ, $#[]Uǀ$$auƀaD$$kǀh"ǀ$UVS$ ǀ$Ɖ$)‰T$$t$$fD$$$`vt],iaQD$$ƀWǀo.ǀǀ( $"[^]U$ǀ/US(%~ $Wf$)‰T$$D$$`vtq$$$ǀ0ǀD.ƀƀ$$#[]US$$w$%ǀhFǀh:ǀh.ǀh"ǀhǀh ǀh$$ǀx0ǀ$[]U$~U$ǀp$ƀǀÐU(~'$ ƀǀUTtǀ6ǀ(Xt ƀXǀǀ((~$*$&U$?$)‰T$$,iaQD$$i~ D$$ǀ$dt$&eu ct ǀS5PR(~cD$$f9t fffǀ(Ttǀ6ǀ(tu9Xt9Zt0ǂ-1ƀXǀ( txuOYt{[tr;td;t\ǂS5ƀYǀ(5x*$%ǀ%4ǀ(UPtD$$ǀƀXƀYǀ((_ ~ $"U$`uƀ`D$$j$ƀ;uǂt(#ǀxǂt(#ǀx(#ǀǀ$USTtǀ6ǀ(Yt ƀYǀǀ((eucuct$,*etƀe$( $+`tƀ`D$$jD$$fƀVƀWǀ\<ǀ8ǀ$ǀ([]UT`tƀ`D$$j\\ƀǀ$ƀVƀWǀ7ǀ(ǀǀ(US(~$'Vf`vt{$$)D$$ ƀWǀ7=ǀ8ǀ(ǀ$ $#[]Uƀǀ$ǀh|u$33 $ǀ)9ǀ$U$/~A|u$ $ǀ9ǀ$Uǀ$D$$$ǀ:ǀpǀ$US$?~xVtof#$f$`vtǂ:ǀ$ $"[]US$$$w$%ǀhFǀh:ǀh.ǀh"ǀhǀh ǀh$ǀ4ǀ$[]US(%~*cuƀ[$ $"Vf`vtV$D$$ ƀWǀ7=ǀ( $#[]U(%~*cuƀ[$ $"T\\ƀǀ$ƀVǀ};ǀ(US(%~*cuƀ[$ $"Wf`vt~$ƀW$$$ǀ=>ǀ( $#[]Uǀ0ÐU2-9(|ǂzAǀ(]U2@9(Ƃ]ƀƀƀ\ǀ4<`ǀpǀ@ǀ(]U(~xRt $ƀƀǀǀǀ)Dǀ(ǀpUPt)$$ǀ$(]~ $"UP(]~$"Tt`pp~s$$ǀpǀ ǀzAǀ(ǀ$$m]u}]U(%~ $TtTpp~J$ǀpǀDǀ( ǂpUS(%~ $Q4ǀ4$lٺVUUU)R$ǀCFǀ([]U(~lƀ[\ƀƀ\ƀ]\$ǀAIU$~%ǀp$ǀMU(ƀ[\\$fǀtǀpǀ$ǀHǀ(US$~29j884ǀ<ɡ<;8|ც<f8ǀ8 8ftǀp$X)‰T$$$)É\$$ ƀ]\\ƀ\$ǀF[]U(ǀ$]$$^DD$X)‰T$$ǀIU(~S$]$^ǀ5PƀVU(~s]$ƀ^ǀ$ǀ9JƀVUS(J~ $(-`w'$$ǀpV(D$$ `vwHH$)‰T$$i~ D$$vu ƃ[$ƀ[ƀƀƀƀ$$ǀǀf#fHD$$fǀ$ǀǀL $#[]U29$|9$ǀTMǀ$ǀ(Uǀ$$ǀsLǀ$ǀ$ǀ(ǀpU$~}ǀ$$$$ǀ$ǀBǀ$UVS$oǀ$<艂LJN‰$4$)‰T$$t$$fD$$$auƀaD$$kǀ>ǀǀ([^]U(~ $Q$$$]$\\ǀEǀ$ƀVǀ(U$ǀQUS(J~ $(-`w$ǀpV (fD$$ `v$f`vtQ,iaQD$$ǀǀ Pǀ(E$$"/$f$$#[]US$$w$8%ǀhFǀh:ǀh.ǀh"ǀhǀh ǀh$ƀW$ǀǀRǀ([]US(%~ $Wf!D$$D$$`vtq$$$ǀSǀ(ƀƀ $#[]U$ǀp$ǀTƀU(~ÐUS]‰fJ9u[]U]u}M‰E BBZ;Uu]u}]UE"f#]UWVS }t(4$ACu)$D$<$$ [^_]Uǀǀ ǀǀ]UWVS U4<<E  ‰    ‰  ‰  ‰; }%=uY%=uƂVf'=u ƂWfE u)9t\$$ [^_]U4D$D$$ƀǀǀ ǀǀU$D$D$$D$D$$ƀÐUUEff@u]UWVS E UUpM]MfAfA]CCFff;F}fA@fi CWG9~Ef@ f@@UB9ut둋E [^_]UWVSu }EE]ffSFf%fCf ~fC f}fCAf= ~fA f=}fAAf Af GfAfA9utxE[^_]UWVSuE4lj\$E D$ D$D$j<$t \$U$ЍD$ t$4D$E$@Ét$t$ D$D$<$5D SDLff9uȍ\$U$ED$ \$HD$U$ƋED$4$[^_]US]C w$T%ǀ@WǀHuǀPǀ@^ǀHCǀ@^ǀH ǀ@L]ǀHǀ@WǀLǀDǀHǀ@]XǀLǀDǀH{ǀ@ǀLǀDǀH:ǀ@ǀLǀDǀHǀ@ǀLǀDǀHǀ@ǀLǀD ǀHzǀ@ǀLǀDǀH<ǀ@ǀLǀDǀH$$$[]UWVSǀdǀhǀlƀXǀdǀhǀlƀXHǀdǀhǀlƀXǀp]UEw$+fǀxfǀzǀtfǀfǀxfǀzǀtfǀfǀxfǀzǀtfǀ*ifǀxfǀzǀtfǀ*+fǀxfǀz{ǀtJfǀ*fǀxfǀz=ǀtfǀ*fǀx{fǀzǀtRfǀ*tfǀx9fǀzǀt&fǀ9fǀxfǀzǀtfǀ x|fx z|fz]UUwY$4+&.'t&Jf R|ыE 9]Ut]UD$D$ D$ ED$$UD$$HUt$и)UD$$nD$$~D$$UT$D$E$UT$D$$UVS untDD$D$$NT$D$$T$ T$D$4$Zt.D$nD$4$.T$ T$nD$4$T$ vT$nD$4$Zta]tXXt ptF.D$~D$D$l+`D$ D$D$H4$vD$؉D$$H[tRXt pu@D$D$D$dD$ D$D$H4$D$D$$HYta\tXXt puFD$nD$~D$h+`D$ D$D$H4$~D$D$$Hpp~ǀp [^]UVSE4nD$ D$®T$4$nD$4$t)‰t vz9sƁYnD$4$ ^tx9~"ƁXvx9vƁX[^]UVS uT$T$D$D$ D$D$H4$ËYtlD$nD$~D$` D$ D$D$H4$áT$ D$T$$ZtE.D$~D$D$` D$ D$D$H4$É$®D$ T$T$$Zt<.D$D$$T$ .D$T$$D$$Rh؃ [^]UD$D$$nD$D$$~D$D$$Uƀ^ƀ]ƀ\ƀ[ǀdǀhǀl$D$D$$x~D$D$$xD$D$$xD$D$$ D$D$$ .D$D$$ ƀYƀZǀtǀ`ƀnUU f|ÐU ft fuf~]UT$D$$UWVSt3D$$)‰tDD$LD$$HT$D$$t>D$D$XD$ D$D$$ tAf9u8D$D$ D$ D$$t18D$$ )‰8D$$ )‰ tg~ ~A Å~+8D$D$ D$ ÉD$$XT$BD$$8PE ff9]uۃ[^_]UVS ]X6t&D$$ǀ8D$D$XD$ D$D$$8T$ 6D$L$$8f)ft*D$$ )‰ [^]UXD$D$$(8D$D$$D$D$$Uƀƀƀǀ ƀǀǀǀƀƀƀǀǀUD$D$$UUǀpfǀ@fǀǀƀƀfǀ@fǀǀ ƀƀfǀt]Uǀǀ]U $t$|$M} ) f΍ f$t$|$]UVSED$E D$E$áǀ pt` t=?v1xڽlP~ ǀڽlP&B} ǀ&Bte ]t t: .t t  [^]UWVS]\$ ED$E D$E$UUEލ}FӉ f$f9uuٍEU PE~ 2E׃9u܍7}Et9}t3É}Ɖ)=~U }Eff$UfED$$Effe[^_]UED$ ED$E D$E$ǀpt4u_t tj^t t;.t t US]D$  D$T$$D$D$@$ED$ D$E D$$[]US]ED$vD$ D$T$$D$D$@$ED$ vD$E D$$[]ÐU}tfǀxlgfǀx$I]UH]u}]} |$$TD$ |$tD$$ƋtTD$D$4$EԉD$TD$4$TD$4$UT$ |T$TD$4$ED$D$ D$xD$6$UT$T$4$]u}]US]C $,ƀǀǀǀǀǀƀǀǀǀƀǀtǀǀƀǀ9ǀƀǀǀ $,$ǀtǀ|ǀtǀ|ǀtǀ|ǀLǀtǀ|Mǀtǀ|*ǀtǀ|ǀtǀ|ǀtǀ|ǀtǀ|ǀtǀ|~ǀtǀ|^ǀtǀ|>ǀtǀ|ǀtǀ|$[]UǀL$UE$$ɐÐUǀL}uǀDǀD]UǀP}uǀHǀH]UU LD$ T$T$E$DUU PD$ T$T$E$HÐU(]u}] \$$EE4Ct$$ljt$\$$}aa~I9E|@E9|2}4u ȋE@9غ9|Ћ]u}]UWVS } a]  \$$0t.t& ft! t&"ƀRƀS\$$6GE_E 4Xt$$0ut$$6u]9}t E붡ƀQU+Ulf\$$6uB\$$ u-ƀT\$$4u ƀU 9} [^_]ÐUS]~l l)ҋd)-9s 9[]US])) t)ڍd)Љ9s 9 l)ڍd)Љ9s 9[]UUtkƀǀpH tҋd)-9s 9]USE t9r @t9r @[]UE=tH]UiU Mb tl t`ҋd)Љ9s 9 t^ҋd)Љ9s 9 l^ҋd)Љ9s 9]U耹tHѺ$ȉUEǂUǂUIUUt"8D$D$$xU(]u}u} )؍ ED$ED$|$D$ D$\$4$áu*|$4$ED$4$ED$4$ t9r @t9r@ȋ]u}]UWVS ƀǀp(\$p$Ɖljك@]pAff)փ9};MuË td))؃@9s 9 [^_]UWVSu} d9sr9vf99u6d dt9v3r)9sf@9ud9|$D$@5hD$ D$D$4$t |$|$ D$D$4$tI9 )5Ƃ;Gf9uhht9r @h[^_]UWVS}H?UD$ЉD$$HU)D$D$D$ D$pD$<$D$ D$E D$<$U T$<$)‰D$D$D$ D$pD$<$5D$E D$<$D$E D$<$xUt9r @D$<$E00),0),]\$D$ D$D$<$\$<$tM,(9|9~.9}$ $U(D$ED$<$t- @ƀƀPuB~ƀƀPtQ8D$ED$$HD$E D$<$8D$<$tHD$<$Č[^_]UƀƀD$D$$Hƀƀƀ$UU tD$D$$XHD$D$$xD$D$$HǀldDht)Tt)Xl)Xƀƀƀǀǀ,ǀƀ}uǀxǀxÐUǀ,]UE(=w(]Uǀ0ǀLUT]UUP]UUQuǀL]UVS(HD$T$@ 4(D3D)H3H)DǀHǀ4ǀ8ǀ<ǀ@[^]UWVS,}u(p54T$PT$D$ D$  L$$t$4D$E D$ D$D$<$ED$4D$ED$ D$D$<$E D$4D$ED$ D$D$<$D?D$؉D$@)$D)؃耉D$t$<$T$D$ 6DD$ D$D$<$ED$ED$<D$ 4D$T$<$ DE)‰D HE)‰HHD$T$@ 0LTtbPt (LQt0,ǀLǀ0Pt (LQt0,ǀLǀ0YPt (L~6Qt0 ,ǀLǀ0, ( (y(W (=~-(Ѓ,[^_]Uǀ(ǀ4ǀ8ǀ<ǀ@ǀDǀHfǀ&ǀTƀPƀQDD$D$$@ÐUfǀfǀfǀfǀ~]UVSM ]E4Af~ff~9u[^]UWVS] uEƀ?ƀ@ƀAƀBEE؍Eԉ$̝ǀĜǀԝǀН ǀ؝u ܜt}$̝D$ȜD$ D$D$$ǀԝǀНǀ؝FEEE$̝!trÜ tB tǀ!`7tǀ`! `!@!@t>ƀfǀ0ǀ  EEE$̝ǀԝǀНǀ؝-ǀԝǀНǀ؝Đ[^]ÐUWVSE} UMMM]u uuEEEEEk}ۉȀ}tEЍGCA9EЍGCA9t;EEEE ~u}!‰Ѓ[^_]UkUU EPEPEP88f )]UkEE UBUBUB88f)Ѻ]UkEE UBUBUB8Ҹ)]UkEE UBUBUB8)¸Ѻ]ÐUM w^vuuu.Bǀ@ǀ*ǀǀ]UM w^vuuu.Bǀ@ǀ*ǀǀ]U ]U,]UM8t4B@8fB:fB*Eǀ|t|t|8y |@t|@t|@ t| @@t|@@t |@t |@t | 8uJ4 tuÜ t |@tT|H4 tuÜ t |t |@4t uh8u_|@@t |@u |fxy |ǀx[^_]UWVS HXVTZffffuf f"*f$,f&8f(:f*<,?-@.A/B0D4.f:"f8خT$D$$ [^_]U8EEE܉$̝U=@VUS]+l)Í[]UP~!@ǀ<2t\D$$uƀǀ8ǀǀ`ǀ<17US$PØD$$ ED$ED$$@8f@&f@(pPv8A UD=wfyffA& fA&@&؉D$$ @ UЉD$$ǀ<1ǀP$[]Up$f-f`~f~U`PD$ D$T$$``uǀ< ǀPUS@ $C;{;tuS<@=@>x;tD$$/x<tD$$0C@@@D$$o@ t_@;f@^f@ff@nf@vf@~ǀ< []UL~a$X)‰T$$ǀ@ǀ<'ǀPǀ`U]u}}w$))*)R)Љ¡X`)]u}]US]H$u$t&u$[]U(]u}tt`` P)Ɖ-hih>N )É]EAhlL$$@D$$ 8$$ǀ< lhih> )ȘCt u ǀ`P9|.8$$ǀ<]u}]UStt ` ǀ``~ ǀ<BP9|.8$$ǀ<[]US$P $$X)É\$$fX*D$ED$$ǀ`EfB @ D$$@D$$ǀ< $[]UP?PT$ D$$B f=wfB @ D$$D$$D$@ $$ǀ<7 ǀPU``uSD$$D$$$ǀ<BǀPUS]D$u>@tt=" t =!" uT$$u$&[]UP6T$4$fx6 vf@~fx6 vf@vfx6 vf@nu$8$8u,$ǀ<ǀ`6$ǀ<ǀTƀǀPUP ~)t$ǀ<7UL~o$ǀ@$ ǀ<ǀTǀPǀ`ƀUL8$8$$8uT$ǀ@ǀ<ǀ\ǀ`ǀPǀ@ǀLU$t`8u-ǂ<ǀ@ǀLǂ@ǀ<ǀP[8u*ǂ@ǀ<ǀP(ǂ@ǀ<ǀLǀ`ǀTƀUL$ǀ@ ǀL$8u$$ƀp$U\\uC$X)ǀ@ǀLU\\uM$ǀ@X)ǀ<)ǀ`Ut*$ǀ@ǀLU P,Ҹ)9L|$ǀ@MU$$ǀ@ǀ<D$$"Utt ` ǀ``~6ǀ<ƀǀTǀPPv~UVS]ƀށt$ƀƀ%= 4=t= ug%= ! t1= ! w =! u=" ft = " t!ؐt&D$$!\$$!%=@t =`4""v!t&!t&wY##w%t&Ct&T$l4&&vw$ fu"t&]!t&T!t&?b b vw`R R w%B vR R vrhw]b b w!b t&b t&u(" v@!t&tx tpmu uPǀ4!:ǀ4!ƀ! "!ځtt=" v=" =w`==t&w3=w==Cv}f-!v9="w#=!'-!t&="A =#A K="B =$" =$" t&wi=" =" w'=" =" =" KD="" ="" t&=!" t&4=B :=B t&w)=!2 #="2 =2 v=!B o=!B t&w=B v="B =!t&w8$8$$ǀ@ǀL$ǀ<,ǀTǀ`ǀPƀ$ǀ@$t ǀ<,/ ǀ<0ǀTǀ`ǀP[$ǀ<ǀTǀ`ǀPƀ$$ǀ@ǀ<ǀ`ǀP$Ƌ$\ǀ@H)P$$ǀ<ǀ` 8$8$$ i%Mb )‰dǀ@$ǀ<ǀ\ǀ`ǀPl$$$$ǀ@ǀ<ƀǀTǀPǀ`8$8$ i%Mb )‰d$$ƀǀ@ǀ<ǀPǀ`ǀTƀ$ǀ<ǀ`ǀP$$ i%Mb )‰dǀ<ǀ@ǀL\8$8$ i%Mb )‰d$$ǀ@ǀ<ǀ\ǀ`ǀP$8$8$$$ǀ<ǀ@sǀL*D$${D$${ǀt[^]UP>~ $`t2D$$tǀPǀ< UP>~ $`t/D$$sƀǀ<w&UL~8$$ǀ4 $`UStt ` ǀ``$$D$$ǀ<8$8u$ǀ@ $ǀ@ǀLPd9~#8u$$#" \9~#8u$$" /t&8$$!" ƀ[]U]utt`PK~/8u$" "$!t& t$!" ƀ`ơP)Áqyǀ`D$$8u3did>N )҉4$`ǀ<t u ǀ`]u]UStt ` ǀ``.ƀpp$X)‰T$$D$$ǀPtZ8u6ǂ<$ǀ@ǀLsǂTǀ<X8uǂTǀ<4ǂ<$ǀ@ǀLƀ.Hu $jD$$T~.Ct~#8u$" $!" ƀTt)PJ~ƀǀLPv~[]UVS.|. B9/ t@ ЃA:4== ttf8uF@tLf|x@fu9f>y3}@t)tD$ $ǀ4 ǂ48uf>y uF@t 4 tƀƀD$$$ǀ<ǀTǀPǀ`ƀtt ` ǀ``~1P~%8u$" $!" Pv~[^]Utt ` ǀ``~kpp$X)‰T$$D$$ǀ<ǀ@(t$Pv~ɐU]ut $T.Fr=. B9/ t@ ЃA:4= t=uH8uF@t.f|x"uf>fy}@t ǂ4 ǂ48uf>yt&uF@t 4 tƀƀD$$$ǀ<$ǀ@MǀTǀ`ǀPTƀPv~]u]UP@~4ǀ`ǀP$@ǀ<3Uu `0 ǀ``P@~P@~D$`$!D$$vǀLǀ@>'$ǀ<$UP~rD$`$!D$$vǀLǀ@>'$ǀ<$rt `0 ǀ``~\D$$qǀ`ǀPǀ<S2$ ǀ@UVSu ]MU8UƀBiɀ%Mb )ʡllhƀځ@t ` @uǁ4`ǁ4 !`uǀa `uǀ@ `uǀ `uǀ`D$ $ǀ$ $ @ݝD$C ЉD$$$ǀPǀ`ǀ<&$ǀ@$ ǁ44 t+$ǀ4$ƀ4 uF u uܝuƀ[^]US`0 `=`_ǁ8u6uƂǀ@ u uܝu&ƀƀztkƀtXD$D$$D$D$$@u tƀǀ<2X=uW>ǀdǀ`=@ u>ݝ ‰T$D$$ǀdǀ`T=@u'Ɓ'ǀdǀ`&=u =u[]ÐUtǀLǀ@R=]UWVSuf{u2xfCF f@FffFLxC C(fC&SfPf@ ?fFA k21)¸؉f~AQ Љ f FfFÜ ttfzt fFffFtfffF?&[^_]U\\uǀ@DǀL]Uǀ@4 u#fxu9D$ $7fxuD$$D$$US iX0%Mb )9L|c$ǀ@ǀ<ǀPǀ`ǀTƀ[]USL~1ǀPX$\ǀ@[]U$L~ ǀ@;UStt`tv`~mD$$$$$\$ǀ<ǀ@;t u ǀ`Lp~$"B ztq.Hu $@D$$T~Cu$" ǀ<ƀT[]UWVS\t خU:.E4=t= uD$UT$$D$$MAfff~fff!¡‰Q)fQMfB"ffB$fi0B0E }u‹ED$D$D$ |$t$$EfDݾUT$D$D$ |$t$$EfDݼML$D$D$ |$t$$EfDƒX|t @Luf@^fE|t @Luf@ffE|t@Ltxf@~fEuf@VfE uf@nfE@uf@vfE@Muf@&f@(4 uu E@uƀ4=t = ~;vtfFrFL%\ʍLĉǃQ9}Ӊǃf~DfBDfBDfBf@f@u~$fCf@ BL5BDtBLBEBN fBHBL%fBJfzJNBFTDVf9~И9~lj΃ufsDfBDfBDfBfpDRfBDPfBDVfB \[^_]UL_~;D$ǀ@ :$ǀ<UtQD$$$ǀ@ :$ǀ<d`09P~ $$" Utt ` ǀ`t \ ǀ\\~b$ǀ@$ǀ<ǀPǀ`ƀ(`~$"Pv~Utt ` ǀ``~$"Pv~Utt ` ǀ``~ $"tǀPPv~UVStt``ơP)Áqyǀ`yD$$did>N )҉4$Ƌ$\ǀ@H)P$$ǀ<ǀ`t u ǀ`PK~$"" ztq.Hu $XD$$T~Cu$!" ǀ<ƀT[^]Uu ǀL6L~*$ǀ@ǀPÐUtt ` ǀ``~#D$$ǀ<1Vd 9P~ $" UStt``¡P)Áqyǀ`*D$$did>N )҉$ǀ<Kƀt u ǀ`Pp~$"A ztq.Hu $XD$$T~Cu$!" ǀ<ƀT[]UWVS D$$$ǀ<.D$$00f F?ff~fff!¡‰Q)fQfi0B0f fBfyf xˆQF|BEf@Hf@Jf@f@f@f@"f@$vf fAf fQffBfB"ffB$ffPDRfADPfADVfA fxu~ǀ ttff耉ƀ4 u&fxuLȘ9~80L4>;,~,+(H0҉4)‰;}=8 $C9  $M f$fKf)‰fSD$D$D$D$ D$ML$$fC}uEf;P&uBfC}~'C+o~ fCfCSMC ! щL$$*[^_]ÃUMDŽDŽ DŽDŽдDŽаDŽ\DŽXufǀ~$fǀfǀ]UWVSU E M‹Z]RUE苂EEEHUU؋}RGЋMEUB‹MO)U u] )SG)F¡MM] fЃf)Иڋ]Ѱ CѴE}f[^_]UWVSk*Uzf+Jf~fff?Hf; Hu#UVUff9|#(fUVUff9f9~f)f9|E U4QƋU Q)Љ1)fuf)ȉf9 f9~[^_]U]UWVSXEE5}ԍ]EDED u EEEUgfffE)9}-UgfffE)9}iEX-UTԉUE|UE=tSE+EEȉEELԋEEЋUDU)‰UEE1X[^_]UWVSfC=u\$D$$fE\$$t9}ǃ uغMb)‰ft=tt9t} ;x;t~;x~!;t~;p~9}u9Ƹ )iMfiU fČ[^_]UWVS\Sf9}ufBf)PufUfEf@fUEǾEEfE9u}KEM HMMEEfE‹MJfM}ƋEBfUƉ+UM+MEUEډD$$E䉄EU)EfE˜$  f  fE)Ei f)Eڃd9dEi fEȺdMܾdEډD$M $EfEĘ$  f  fEf)Eڃ}܁se[^_]UWVS°R$T$f+?@Hf=~f-f=ff*u"ffB"D$ vT$D$$fBfBk*"ƻS"D$ vD$CD$$ىfF uk*"ƻ K"T$ vD$CD$ $ډpfFuǃ* "NNf+DN*fDMʘi )¡fHHf9~Ãuf)Pt鍴}v [^_]UWVS ǡi*0`@$f)ƻ$f_uރ [^_]UWVS E$߾ 1)‰1)M9}л=?=?E‰$i*0DUfr` [^_]US4E]ҋJf+KfJ~uރ4[]UVS0~ET]΋Kf)J~u uQTf+Q~fVÃu颋.)ƒ0[^]US4T~#~ EU h;ucEW>4~MfEEB} ;uMfEEE } 9}EUE [^_]ÐUǀǀǀǀǀǀԉǀЉǀ,ǀ0ƀƀƀƀƀƀ ƀ ƀ ƀ ƀ ƀƀƀƀƀƀƀƀƀƀƀƀƀǀȉ]UUЉptUVSuƂ~y ƀFuFl)19u no |[^]UUx]UWVS X!Y ƀ}t(lÃm 8Ӄ ƒtu)'D$$&D$$'D$$(D$$)9~ȉ9~ȉ[y ox*9~ȉ [^_]UƀȉtȉtȉtƀȉtƀPȉ t $ĉUƀȉ$8`ut ȉufy ȉ%uȉƀPuȉƀPuȉ $ĉ%U8]u}E8$@TƀƀƀƀEP$ƀ|ƀkƀ Zƀ Iƀ 8UB $%ƀEP(ƀƀƀƀƀȉ@ƀƀweȉ@Xt ǀTƀƀ+UZ Sf  f%?fEKfC ‰ f%?fESfC f%?fEfC fU]MDQ?fDSn}3EtxU Pf;qÃu~ uEUDUfE߀}}؃v3EtxU؍ Pf;qÃu~uETE8}tT$$UT$$VƀD$UB D$$ZƀLu>t5ƀ"EE]u}]U$$D$$U$$D$$Uǀĩt ǀt ǀHt&$ t $t&$@t $t $Uƀͩǀĩ$$$$ǀǀH$$UD$E$ǀlǀpfǀԉǀЉU l;0@ƀǀ0t"$ ǀ0ltСƀƀƀƀƀƀ[]Uǀl)ǀpǀD$ D$@D$̉$uƀuƀPUD$$ US$kD$ D$@D$̉$vxƀځ u tQ D$ D$L$L$D$T$ D$̉D$t$ t5 Ѓ$ǀlǀptuTǀlǀp P,2)Љ Mb)‰@?ǀlǀp k gfff)‰<$$$[]UWVS M uUtQxQQ QĉỦUA$$$ט)‰E FD$U$؉FFD$E$܉F0D$U$DD$$fǀ@D$$fǀ@f+F*$F*D$$̉u x [^_]US$]E t2D$TD$D$ D$D$ $D$D$$D$XD$$ $[]UƀD$$PUWVSUU E4=T^ff9ufD0fDW uTE$\$\$ D$D$$ [^_]UWVSuF$iN` TFTF~ff%f?fF.~ t*FFFkFkdÉFkTF@ FNڃF(È^F,!ЈFF(Ѓ !ЈF~ t UFF@UF~7fF fF" fF fF"FD$F D$ F0D$FD$$fF&FD$F D$ F0D$FD$$fF(FD$F D$ F0D$FD$$fF*FD$F D$ F0D$FD$$fF,[^_]UM(U,EE BEBEB EB0EB E BE$Bu B$@B%u B$ B%B$B%$U `#Љ# `#‰#l#<@ubǂǀi##i####< u_ǂǀi##i####1ǂǀ##]USU] W#t6t# ft# p# fp#4r# fr# n# fn#[]Uǀ$U$]UX]u}i6D$ủt$}܉|$ _#D$^#D$$t$ ut$_#D$$vD$ |$t$$]u}]UWVSEU p$tEU҉lMh}|}E x\W#t{UT$M L$ D$t#D$l<$ED$D$h $}|$|$ D$r#D$l$/ML$} |$ D$r#D$l$##fEfM##fEfM##fEfMiXˁÀD6D$|#T$}|$D$ D$D$\$}LDf#f# TDf#f# TDf#f#ED$D6D$ D$ n#D$l$ML$\<$Ph}|$#D$ #D$H#T$h$w_#XvD$#D$ |$D6D$h<$l#cڍ#Džd~FDžd9vdǃ9uc)\9u #)##;#vE E$#;#sE E$ihdidD$D$ vD$d|$$dy iЃtd;t ;^^;ih}~hi޹ fDŽfDŽfyf fyf9Mu d$vE E$ wE E$s;!ivD$ 6D$ED$D$|#D$iD$ D$H#D$$;teW#t{UT$T$ D$ n#D$l<$ED$D$h $}|$ED$ D$ p#D$l$/ML$}|$ D$ n#D$l$ )Љǃyi t2ǀ|U $w$$_;|=6iǀ;!Ëiu$L#H#$ev#f#EE$Mxx+|;pt|}[^_]UWVS,M0u E$EU(U},U4tIˡ|#D$L$$f|uf|tt/|#D$$fǀ#@H#D$$ED$ D$‰D$‰D$ED$ED$ ED$ED$E $H#D$$$H#D$E$_#$ǀ#v#X#L f#Uǀǀǀǀd fǀfǀfǀfǀfǀfǀfǀfǀƀ#D$D$$@ǀ#`##fǀ#fǀ#fǀ#fǀ#fǀ#fǀ#ǀ$,[^_]ÐUǀU]UWVSU} Et MEUUME܉D$D$$MĉL$ E܉D$]\$M $ủt$ \$cD$E$|$t$M܉L$ cD$bD$E$ML$D$ D$LT$E$Ƌ|$$|$ ML$EĉD$D$D$T$ T$LD$M $|$|$ D$ rD$E$[t>|$|$M $|$|$ D$ tD$E$}tPtJu2PL$zfEEE+E9EČ[^_]UWVS,E(uUUM M}$tIáD$\$$f|uf|tt/D$$fǀ@LD$$ED$ D$‰D$‰D$ED$ED$ D$ED$E $LD$$%LD$E$c$ǀz\L fǀfǀfǀfǀfǀfǀfǀfǀfǀƀǀ,[^_]ÐU]US$]M ED$D$$EQD$ED$ D$D$D$ D$L$$$[]ÐUWVS EU fB<uEEEEfuf؃u1fu E X.Ef9!ƒ;Muċuf‹UE [^_]UWVSU}EuE  Cff)f%fVCff)f%fVCff)f%fVCff)f%fVE M 9]`[^_]Uǀƀ]Uƀ]UWVSU} JǀǀǀT5;9u[^_]UǀƀǀǀǀǀǀǀTǀƀƀD$ $U}uǀǀU ]UVSUu B0ƀ9t)19u[^]UE D$E$ƀUWVS,E EE܋}  ~ t~tE))9uaESTǀM39uEEE$T~#;}uu ƀƀt!D$ E D$D$E$E,[^_]US]E D$$؃[]US]E D$$؃[]Uǀ]UUǀ ǀǀ\ǀXǀ`]UU]Uƀ]U(]u}}T 9$t=`t4D$D$$ǀED$1+\$UE E ‹\ X\XXX?FXXFX\UE ‹\ X\\E X\XVX ˆVXXFXXVX ˆVXXFX\` ] E D$<$]u}]ÐUǀ$ǀ ǀǀǀǀ,]Uǀ$ǀPǀƀ<ǀ,ƀTƀ\ƀ]ƀd]UWVS,ME ȉE$D$ ] \$\$ $(  ‰  ‰  ‰ ]  ‰ ;upu %=uDf=uE4$f=uE4$ uuf=uE4$ u҃E+E 9,[^_]UE D$E$ US]E D$$,؃[]Uǀ,]Up`ǀ$ǀ ǀǀǀƀ0ǀHǀDǀ4ǀ8]U}uǀ(ǀ(U ]Uǀ,]UUǀ,0ǀHǀ4ǀ8]UU ]UWVS\U 0+H`HH ǀHEЋ`U:rUċMYMȋE@EƒE‰U‰E‹EЃ~$EUЋ`EE܉$Q?؋MA ‹EЋ8 4858}~2}틆44858ы]EЃEE@E EE% EE ڋ]C ‹E 488~-4488ӍED$)lj<$T$E$E\[^_]UWVS|EE EEĉD$U T$E%$$EED$ M L$L$E$(E+E EEEUM  U% ѠE <u ]@<daH;hOl`tL h `t'ǂlLhǂlL h um`Aƃu 6L`t[ǂlL h h+`Dƃu6LL~WǀLKHuBTu9@t<L<L@HutƂ<@H`@>OH@H;LEED$`D$H$}uWE HE`EE$ƀ]ǀXD@ƀ<ǀH]\u$@\N@ )ȉEt u" EXUtMutX;P|XXǀ@ XP9E)+@)֍D0 U4ЋE)$E~ED$ EĉD$D$$(EEE uEEE$ƀ\Eyt Ƃ]dHH~2ƀ]EE+@EE$@@~%=4EtEu@t0@uut fu|0 \P9|}}uw)ЋMDEE+E$E~"ED$ EĉD$D$$(EEE EEEEE$E~>}t5ƀ<ǀHV@ƀ]EmE+E ;E-U$|[^_]UǀP]UǀP]Uh]u}]u}t$E D$ D$D$Z<$\$t$E$P\$\$ D$D$A-<$]u}]UǀPUE$ÐU+ث+ܩ;ةxE$Uǀ ǀ ]UƀΩƀϩUԩ]UVS]ֺ=v+=v=?w=?v[^]UǀYǀǀǀƀЩ]Uǀ[ǀȩ]Uǀ]Uǀܩǀة]UD$$$UD$$$US$á$Ә)‰Ѓ[]US$á$Ә)‰Ѓ[]U8D$$ D$$D$$UVSu6D$؉D$$tȲD$D$$Pt\D$D$$))X)IJ)X[^]UVS }f%@Hf~ƉD$8D$ ÉD$D$$fyf~fx ÃةѡܩةD$$ܩD$$ [^]UWVS VUUUEE)NjE$4?D$4$)‰ͩt,HD$4$)‰D$<$ΩtDԩ@ƂΩ ))X)IJ)Xϩt-ƀϩԩ$ԩ$8D$8D$$MEXIJX [^_]U(HtJD$D$XD$h+LD$ D$D$`E$ǀ[U(tJxD$D$IJD$h+D$ D$D$`E$ǀ[US$ ĩtOܩxT$8T$D$hD$ D$ةD$E$ȩu$t ǀǀȩ"Ht ǀyǀȩ$[]US]$.$$<ǀ[]USVUUU)áHT$ xT$D$$T$ xT$D$$D$$xT$HD$$T$xD$$T$xD$$$؃[]UVS VUUU)áHT$ xT$D$$T$ xT$D$$D$$xT$HD$$ ĩtMܩxT$8T$XD$hD$ D$ةD$$ [^]UVS@] ܩxT$8T$D$D$ D$ةD$$ƋtjD$D$IJD$ D$ D$D$`$xT$ D$T$6$PD$D$XD$L D$ D$D$`$D$ D$D$4$xT$ D$T$6$]؉\$4$x\$ D$D$4$@[^]UVS ]=Ƌ̩tJȩu$"̩t#ȩȩ~ǀȩЩ2D$HD$<D$D$ D$D$4$6T$ HD$T$$D$D$$ЩtgͩD$HD$<D$D$ D$D$4$fǀTfǀVͩt/D$6$)‰ [^]UVS@ܩxL$8L$XT$D$ D$ةT$$ƍ]؉\$$x\$ D$D$4$D$ D$D$4$@[^]US]̩tȩuXT$ L$)Ѝ#%$ȩȩ~ǀȩ[]UVS u#T$D$D$D$ D$D$04$#D$6$)‰. [^]UVSu8\$D$8D$D$D$ D$D$0$8D$\$$ tǀةǀܩƀϩǀԩ[^]USME$U EǀLuáD$$`P9~ҡL9+E9L~LD$D$ +LD$ED$$ELT4\$D$8D$D$+TD$ D$`D$`$TXD$\$$[]USME$U E"ǀuáD$$`P9~ҡ9+E9~D$D$ +D$ED$$E4\$D$8D$D$+D$ D$`D$`$IJD$\$$[]US$]u ȩ HD$xD$$T$HD$$T$HD$$tDHD$D$IJD$hD$ D$D$`$HtdD$D$XD$hD$ D$D$`$HD$D$$`ȩȩ~ǀȩ$[]UWVSLuVUUU)‰UЋu ȩxD$D$D$D$ D$D$04$<6xD$<$)‰tbD$D$IJD$D$ D$D$`4$xT$ D$T$<$PD$D$XD$D$ D$D$`4$D$ D$D$4$xT$ D$T$<$D$ D$D$4$xD$<$)‰]6D$D$$xD$D$$D$ D$D$4$HD$D$6$]ԉ\$EЉ$H\$ D$D$EЉ$EЃL[^_]UHD$D$$`UD$D$$D$D$$ǀǀǀǀGU8D$D$$ D$D$$@ǀǀnUVS0MVUUU)ơxD$ɉ $]؉\$4$x\$ D$D$4$D$ D$D$4$0[^]UǀĩƀͩD$D$$D$D$$ 8D$D$$ HD$D$$xD$D$$`ƀ̩ǀȩƀЩƀΩƀϩǀԩH!XǀةǀܩǀǀǀǀǀƀǀIJȲD$D$$ D$D$$D$D$$`ǀHƀPƀǀTǀǀ|X\D$D$$ D$D$$D$D$$`UUED$ ED$ED$E $Ui(Ȱ]UU\]UU`]UUа]UU԰]UWVSuED$D$$ ) y x Ȱ~ލED$4\$ ‰D$D$4$\$ ljD$D$4$[^_]UffD$D$@$ffD$D$@$UVS]ut$$ 9s9vt$ E D$L$$ǀаt h԰tB hڽlP~ ǀڽlP&B} ǀ&B[^]UVSu E ff ڰT$ D$L$4$ED$ ڰD$ED$4$[^]UVS uȰİffED$dD$ L$¼T$4$dD$ D$D$4$ED$ dD$E D$4$ [^]UED$ ڰD$E D$E$UED$ dD$E D$E$USED$ ED$E D$E$áǀİ\t hİ`t hȰ[]USfǀ@fǀffǀḬ̇ȰdD$$ ǀǀǀ$$ڰD$$`ǀfǀ@fǀffǀ VUUU)‰$$[]USUE P E؋ ḭ E ii$i[]UE D$E$Uǀ]Uǀ]UǀUE$ÐUUE Pƀ U]UWVS,}?E܋E+u܉t$<$EE )É\$<$E\$t$<$EEE}t+E)É\$<$E\$t$<$E}a }aE܍\0\$$Ɖ\$$9|TUU9EM9~}t'EEMM9~ ؃,[^_]UWVS< lU؋lEE} E EUԋM QD$ E܉D$U؉T$$!Eututq}ԃ ]ԃuԋM YD$ D$E؉D$$t{9t 7EE)EE$E U9UCEtEE$EtEE$<[^_]ÐUE]Uu'ǀ ]Uuǀ@ǀ8`]Uƀ]Uƀ ]Uƀ ]Uƀ ]Uƀ2]UǀHǀLƀ4]UL;H]Uƀ3 <]Uƀ3 <]Uƀ3 <]UǀU]Uǀ]U$U]UE耹tHѺ$ȉU(]u}}u ))؃;|]ED$ED$t$$D$  D$ T$<$t$<$Ћ]u}]UWVS} T$ZD$))؃%$)T$D$$T$D$$ǀHt+4D$8D$ E D$D$<$1EE@EED$U T$<$t[ED$B$D$ED$ D$D$<$D$ UT$D$<$28}‰ր4t4t0D$<$Hlj)‰HED$@BPD$ED$ D$8D$<$D$ UT$D$<$t94t0D$<$Llj)‰Lu 3}uvD$<$áD$<$ D߉)؉DE D$<$ )‰ tzD$hD$ED$ D$D$<$h4H$f9u3}u~8ttD$@D$ED$ <D$L$<$@84HPf9uEU9U|$D$$|$D$$D$D$<$D$<$)‰D$D$ D$D$<$t9XƀEE$ܻu+P ~ƀEE$ܻD$<$?Č[^_]UE D$ED$$USuDD$PD$ D$HD$`$@ǀ8H[]USuDD$$D$ D$`D$$ǀ`[]UWVSULMܻHǀT0t*D$ D$ D$%$(D$ D$ D$@$ t D$D$$T$D$$T$D$$T$D$$8D$D$$D$D$$$D$D$$hD$D$$PD$D$$`D$D$$`ƀǀ4ǀDƀ1ǀ@ƀ2ƀ3ƀ4ǀ8`ǀ ǀƀƀ ƀLu}8+~0؉D$D$$Lu3$+ ~؉D$D$$ED$E D$E$[^_]UWVS]u }E0MMb )ʋ MM )¡l ҃ȸ$)9~0ED$|$4$ED$|$4$E$D$ E D$|$4$[^_]ÐUS 0i2U1É8[]U 18iB0 ]UǀDǀH]U`]Ud]U]U]U]U]U]U]U]Uy]Uj]U[]UWVSEU $T$áHD$T$ ӉU) 01Ɖ4E%45D3D)H3H)Ѝ<ftBEUT$$M ËD١HDǀHEe[^_]U$D$UWVSLu]E D$ ED$\$ED$ED$E D$ 8D$4D$4$E؋ED$(PD$ \$D$4$ED$(D$ \$D$4$LE)‰LPE)‰PTE)‰TXE)‰X(,(5TLXEPE܋DNjUU) ÉDHM})) ȉHHD$T$ 01@\`tlJ4dtPl9\|ZlJ@8ǀ@ǀ\ǃ@ǀ\8 44y4m4=~-4EE؃L[^_]Uǀ4<8ǀ(ǀDǀHǀLǀPǀTǀXPD$ D$D$$ZD$ $D$D$$Z0$UVS] M  l lƉ  l l$,=@u!10 0i2U1É<[^]U]UWVS 3) i!)ǁǁǁt")ʡu[^_]U]Uƀ]Uƀ]U]Uǀǀǀǀǀǀǀ]UWVS\]u 7ED$D$ t$D$$ED$D$ t$D$$5 E)‰ E)‰ E)‰ E)‰=ڋƍ)щM+)Ћ)Ћ)U5E)ЋUЉ+ЋЉEE+E)Ћ5)Ћ)E$T$@ u |X+~}D$ L$$T$E܉D$ ÉD$$T$ D$D$T$ $T$ D$E܋UD$T$ $T$] 1)=T~ Ɓr}NEfEE܉D$ ED$$T$]ԉ\$ D$$T$\$E܋UD$T$ EԋU؉$T$\$ D$EԋU؉$T$UfUfEfEfE]ủt$ ÉD$E̋UЉ$T$t$ ۉ\$E̋UЉ$T$EȉD$D$ E̋UЉD$T$ EԋU؉$T$E)Ћ‰\[^_]UVSƀǀƀǀǀfǀfǀfǀfǀffffffffD$ D$D$$ D$ D$D$$ [^]U]u}]ff=@E X]ffɉMډE]u}]ÐUUwO$mB$ME 4Et&'EEEt&E$US]D$$D$$E D$$[]US]E D$$FT$xD$ $$$$u‰$<T$ T$ثD$$u[]UWVS|uED$E D$$<D$$ V&F(<V"9}F$9~ÉD$$EEtC9~‰9}EED$$~eUdVh~:ueFD$$FVBD$$FD$$D$d$E$d$D$ D$FD$h$UT$D$ FD$FD$h$~ ^FD$$FVBD$$FD$$ FD$$F fEVfUEf~6tOhF4@ȺMb)ʉH~H  9EUT$$U؉%=!M%"="!ÁDDu UE<f~ ed$|$\$ED$ FD$hD$d$D$d$E$VD$E؉D$D$VT$UT$ FD$hD$$t$ED$ hD$ED$U$|[^_]Uƀؐ]Uƀؐ]UST;$D$$L$ D$L$$@T9cE D$D$E$)L$D$)%$[]UWVSUE ED$$ǀUǀƀؐ؋D$$~_#D$ D$D$$D$D$ D$D$ۉ$[^_]ÐUǀTFǀ\]UǀdǀTEǀX]UǀdǀTEǀX]UǀTBǀX]U]uu] \$4$PhED$\$4$T]u]UUE ff@9u]UWVSM uEEy=f~=f~fȍL f=ȍL Bfxf=>ЍTf=ЍTi fi fFAT fnf9]t u]ԉ\$E$ủt$ \$D$E$t$$L[^_]UWVSL}U 4]M։f:xfCfA fC_fAfxx fCfIfC_AfwfA9u]ԉ\$<$ủt$ \$XD$<$t$$L[^_]UWVS UXЉ~U9udD$ ]̉\$\$<$`ut$ \$XD$<$ED$ D$t$E$ED$D$ D$D$E$Č[^_]Uh]u}]}|$ \D$D$4$ED$ D$|$$ED$D$ D$D$Dۉ$\\~ ǀ\]u}]ÐUU]UWVSu EDž?1d9wƉ~ԋM) MM2`] 9EE4TLDdDžUM식]苵uE Dž?DžMh[^_]UWVSUEEEЉEUUm Mu 1˃u1΃Ѓȃ ƋExP )%)€)ځӉ)UfBffJMyQ )%)€)ځӉ)ufFffNEU E muM9M[^_]UWVSLEE DžE UIt)` `` ҉ہ`ɋBPx BZBr M9‹T+Dѥ9}s4Ȉ!=sȈu_4]DDDAuEDžDž49e1Ѓ9uR4<M;0w-0)ы ЋU:9vy@3M 9EE@ED4E DžDžDž똁L[^_]UWVS$UEEEЉEUUm@UM  UEӃ ËM M܃1 ȉEEpP )%)€)ځӉ)UfBffJMyQE )%E)€)ځӉ)UfBffJMMԃMЋE E mUE9EE $[^_]ÐUWVS,M EA A QA A ơE8tquHEEE؉$%9u EE܉EE؉$ZE}0tP ЉƁ ЉǁU ЉÁE%EN,[^_]Uǀǀǀ,T]UUPƀ\ǀX]US]tdƀdǀlǀhƀTǀL`ǀH[]UƀTǀLÐUԉ;<| $!tT,,~JD$$ƀ ǀ,ǀlb ǂ,UЉ~AD$$ǀp"bǀԉǀЉU ǀƀfD$$D$$)D$$j̉u u xƀ ǀlbǀpUWǀ<ǀЉǀԉǀ,ǀlǀԉUSD$$jvD$$vƀǀlVǀpUW x9tk <2 gfff)‹؉B<ǀЉǀԉǀ,tuƀ[]US4tǀlWǀԉԉ$t)%=u $ǀԉ,k  9,~ND$$D$$D$$ǀ,ttƀP@]0PƂD$$*D$$D$$D$$t* t =ƀ̉u u x;|'~-ǂƀ*PuP ǀPTǂT2y j;X;Lu;2t'LuǂED$E$fT$T$ T$T$ L$̉T$$E;E; ǀD$$+D$$ƀ*TuT1 ǀT2ƀ8$;P ~G̉u>$D$$8$Ƃ8tu ǀH̉D$$ D$$ D$$ \$$ $ $#Lt LHt=HHu&D$$W Lt2D$$&t!$tD$$,HtILu@$D$$8 @HuǀƀD$$(D&D$$%ǀlcǀԉ4[]UЉD$$lubǀԉt%t$ǀpǀЉ ǀpUԉ;<| $!ƀ D$$ttƀǀ0ǀlpu`ǀԉt%t$ǀpǀЉUtQD$$$ǀlƀƀǀԉԉ; | $"ÐUЉ;@|7Ƃƀ2tƀ̩ǀp]Uԉ;D|4Ƃǀ<ǀlǀԉ]Uǀlo]Uǀl4o]Uԉ;<|t!2 $,,vƀ D$$ǀ,ǀlCfǀpd܉@@ǀЉǀ,U]u}ԉ;<|t!2 $QD$$ƀ u Dƀ$$X)‰T$$D$$ $ǀlgǀԉ5VUUUщ)VUUU)ڍT dž<@y<~<$ǃldǀԉ]u}]Uԉ;<ƀǀĩt&$ t $ƀǀ0ǀlhǀԉUԉ~!$ǀlhUSԉ%=uÉ$\$$D$$ǀĩtt$X)‰T$$ǀliǀԉ[]USԉ%=uÉ$\$$D$$ǀĩǀljƀ ƀ k gfff)؉`<tu ؉<[]USԉ u %=uÉ$\$$D$$ǀĩot!$t$$ǀlk[]USԉ;<|t"2 $ u u tƀ D$$ƀ D$$ttuƀ Q)ƒ <ǀllǀԉ[]USԉ;<%=uÉ$\$$D$$D$$tAy%D$$.ƀǀ0$$$ƀ̩tuNǀĩ$$$$ǀlnǀĩ$$D$$ǀlǀpǀԉǀ@[]UǀleUǀl1eUtfyttttt $t $D$$ȲD$$ \D$$ ttƀu$ $D$$!D$$"ǀlǀpǀЉÐUԉ;<| ǂl{]Uǀl}]Uǀl}]UЉ~2D$$ǀp(rǀЉUЉ;@|ittƀD$$ǀp[qǀЉUЉD$$ǀp~ǀЉǀlrǀԉtu܉耉<؉耉<Uԉ;<|~ tƂ1tǀl`sǀԉ t؉X<؉,<Uԉ;<|Ntvǀls t <X <,Uԉ;<|Tttǀl:t t <  <Uԉ;<|Tttǀlt t <  <UVSԉ;< $X)‰T$$D$E)É\$$ $))ot!$@tƀtfyƀttƀ3ǀlu<[^]USԉ;<|K$$ǀlx<[]USԉ;<|nt&$@t $ǀlvz gfff)؉<[]Uԉ;<|}t ǂt ǀHt&$@t $ǀlx<@Uԉ;<t ǂt ǀHt&$@t $ǀlv<@USԉ;<t>u5y'ƀ2D$$-ƀ4ǀlLv @gfff)؉<[]Uԉ;<t ǂt ǀHt&$@t $t>u5y'ƀ2D$$-ǀltw<Uԉ;<$ 9}UD$$y1ƀPD$$+tƀPǀl{USԉ;<1ǂǀH$$$á$Ә9D$$D$$y1ƀPD$$+ǀlq6$ƀPǀly<[]USԉ;<tƀ D$$ƀ D$$t ǀt ǀHt&$@t $ǀl} Q)؉<ǀ,ǀԉ[]U؉@9ԉǂǀH$$tuOtt$ǀlǀl}Uǀl3qUǀlGqU$u$ $D$$!D$$"ǀlUЉ~-D$$ǀpÐUԉ~>t $t $ǀloUЉl%=u $D$$ǀĩt ǀt ǀHt&$ t $t&$@t $ƀƀǀpbǀ@UЉ;@|;D$$ @ǀpUЉ;@K%=u $t$$$$D$$ƀЩǀĩt ǀt ǀHt&$ t $t&$@t $ @ǀp$UЉ;@|wtu $ t @@ )¸@ǀpvUԉ;<| $B t~,,~tD$$ƀ ǀ,ǀlǀԉǀp7ƀ ǂ,UWVS Љ;@ ۃ㰁9~t!$ƀЩtN$á$f9~&T$HD$$D$$fǀ@fǀǀĩt ǀt ǀHtXD$$ á$ǡ$D$$ǍC)‰T$$D$$D$$ǀp Ҹ@ [^_]UЉ;@%=u $ǀpǀl[ x9tk <% ؉B<Uԉ;<|0t$"t"B $lD$$ D$$YƀXD$$ no ‰YtMmtDXt ht2 \t'lt|ptT[yKoyBXt ht0 \t%lt|pD$$"ǀlUԉ;<|'ut"B $t(D$$ǀl|U ԉ;<|KlVЃTLBDX9}ullt]DDuE`Dž\\@`1tD9wdƃ~Ӌ\Ed ddMM2\\nh9] tOEE DžllDԉTBDԉXtĠ[^_]ÐUWVSu]EU<M  ƒMffAM9u[^_]UWVS]uM fEEU<M Q€ kE!ЈM ;U!ˆE;}t릃[^_]ÐUWVSu }EE^iЪjij‰ffW9uu[^_]UWVSEE EE 0xƉi_imuiMEf0fxE EE 9Eu[^_]ÐUWVSlu UEM ^$BJfhZ fxB f`Jfb BfEfMJBfEfM^ v"uEEUDžuAM] 苵`fdbffM]$4b`fd13E1ƉuU Af8fHtu(T](Dtfbff`ff+xf6f+hM,fD6ffD f\UL][DUR6][\rL x))ڋӋډ)x&fxff#fb( fxD0f#fbx'fhff#f`) fhDf#f`E,E(HŃ8 ǃ  ۀ@MU11ƒuȃ 3M1ȃ ׉}U]E1Љ1‹1!1ƒ 3M1ى#1 b u.UE ƒ1 11+U1E ‹E1؋M1ȃ уEM+E ;EUBhfZxfr `fB bfZF]fCfVFfCfSȁl[^_]UWVSUBXzr J fMBfE BfEfMJBfEfMU R \M I"`EEdDžPDžTEEU4MUuLDE TuD3EuD0t͋GHD$G0D$$UB]CBC BC BCB CuV`)ЉCF`D$$G$E,[^_]UED$ED$ ED$E D$E$;Uǀ;]Uǀ;UÐUEPƀƀƀǀ]UWVSUUEE 8E =t&t/U? Ѓ?1UUE 2U]1Ӎу 1E11EEUEE]$E 1M1E1ȈEڃU؃= 211шME EE]UEEEuU  2M1E1ȃ3ǃMUuE EU ЋUUmUሐUU∐[^_]ÐUED$ED$ ED$E D$E$HUVSË9}ΉЃu[^]UVS0;,‰ǀ,ǀ0t<Z Z fZ ١fX uɉ[^]UWVSy  qTA fpT~ uƀfǀƀf  Q ~ u f< f>ǀH4ǀL[^_]UUǀPƀ ҋdPf<<f>ǀH9ǀLfǀ@@]UUƀfǀ ҋdP@f<f>ǀH+7ǀL]UUƀfǀ ҋdPf<f>uǀH4ǀL]UE$ƀUWVS|}fEȋ 4t fEȃEEUU]ȉ]U ]]YE؋}zUQEEQ)Љ1);E}LY+EEE؃};]t'qR)Љ1);E}˻U؉E9}}%Mu}]fP9Mu}E}9EsučCE U<}yfE}׉}f9y|2AUf;Q~6E}8}fQ}č 8BfJhEU9~ L|[^_]U]UE]UWVS M]  uuƀ ƀ ƀ Ƅ Ƅ Ƅ  uƄ  <<uƄ  <uƄ  n  8v: vƀ +8s: v ƀ  8s 8sƀ  D$$fǀ Њfǀ 0u 48qt @ f  ftDf; ~rtf  f; }Btf i f=/u+ fЊ~ f)fz  f)fz fǀ hH f puaH f pu utu  9} fǂ  [^_]UWVS}; tuܡtD$$D$$ǀǀǀƀBƀCfǀ ǀHM.=@dT)EEEE)EE|[^_]UWVSƀǀEEd)EDžxDž|ED$ D D$ D$$UT$$1)9]!ÍED$$)9|~ x|9Y|~/*Dt܃xxDDžxDž|r=~-uċ9~9u fLJ| fLJ|Džt D59|勅tFt3Du~WUĉp}lptlljfN59tt I~muċ9|É׃9tNt2 D$ D$$t 봻뭁Ĝ[^_]UWVSlEEEEEE  DuUduEEtЉfU fDŽtfǀtSMMEEMfBt AtډUfQt4EEMfBt AtډUfQtpzU L$ L$tT$$E E9l[^_]UWVS< D$D$$tfP xtfP xu P$D$ D$D$$$D$D$ D$D$$T$T$ dD$T$$$T$ dD$T$$fH y fDŽPtfDŽPtuɃt1ut$t$tf$t$EE@D MЍÃu\9]~]̃uf}܋E9|Jt$$Ƅ tD$$աƄu<[^_]UD$ED$$ǀH3EǀU 8UWVSL]u 4uExExEEEEElEhED$$ED$$ED$t$$ 9U} HU]̋Mԃ*)Ǎ)ljuȡ'C&Bu7ƀBUȃ:~(ttu݋MԃyMԃdupȃu؀tu E耉Eڋuȋ؉EЋ9El4tt*ECҋM)fCt0EB~])É봋u)փ}l~0}ECtft)UfSUfPttu Z Q';D$D$$f uEt$ ] tD$D$$t$t$ D$D$$t$ dD$t$$T$ dD$T$$fyffǀuكE}$EufCǀON)k49u(ttuݡU;TƀC4;.PáD$\$$D$\$${Yttttu;5Eĉ9E Uĉ}1HMM9M~0EfDŽBtfDŽBtuСǀƀCE}~m~E]9]t EL[^_]UWVS4D$$E$U (dE0CU S)Љ¡~0f@ً0f@)׉yV,y F,~ f)u4fu4f{~ ?fU4 ?f)U4f{~,f)U4,fE4f C)C‹EUf UU f+ȋUf!ƃE 0E 9(tEUEte4N9}Ãuס>))u5t3}~]K1fKЃ9Mufd\$ ED$LD$U$\$$TD$$PD$$[^_]UWVSu >`RPUXTdf\}yغ;`|;PN"GAQ)Ѝf]fGf+Ћ]ff\fB\9Tt]Eg=t<}~(dVÃ1fV9Utf]ĉ\$ dD$LD$E$\$$TD$XXD$$ļ[^_]Ë`‰G`fAfQ`ډ_UWVSu EL~U9uPD$ ]ĉ\$\$<$dD$ \$LD$<$dT$ <D$dD$E$ dE`<]fA)A‰E f+fEfE E9uTD$`D$$Ĭ[^_]UWVS] }UǀPǀH[@ǀLƀҍUGfH EGfH u  A Ãu溫*)d]XÉf@ǀ,ǀ0D$D$$`ƀ[^_]Uǀ,ǀ0D$D$$`UWVS } tuܡǀǀǀƀBƀCU UEuEuD$ED$$tD$$D$D$$`ǀHM.fǀ  [^_]UWVS,EESEy:tfى@9~@9`Bw4Dž.DžDž DžF鉅$8L[^_]ÐU]UWVSEEEU샼,uM8à u~f uuEE}t뜋u ~룃[^_]U,u ǀu]UWVSufEEf+A f1f)f[@U D u΃u[^_]UM, u]UDt ǀpCǀǀǀxǀǀhǀǀǀǀǀǀ ǀ ǀdwǀǀǀDǀHǀDǀDǀu ǀDu ǀ]UU]UM]UU]UU]US],u[]UtC]Uh ǀhh]UWVS EPU uEquEE  x\xЁ f E)+]9fU9s) 09uփ;}uUE9w [^_]UWVS8EEUU} }E*EE)RU)‰Ћ}}ЋUUԋ}<}EEEEUȅBt1}Efx}؋+EE}fTGEumm}uAED$UT$}؋$EEEE}tEUԍ4BN8[^_]UWVSLtF=u)f^u܍,D$4$E)Љƒ uExE}.EU,UEEE EE EEfAtMfHtMfHt 7fHtڋ]ˡfXt]ˡfXt]ˡfXt fHtMUƄ UƄE}ǀ,ǀ0ǀ4ǀ8ǀ<ǀ@ǀx+=EGtՃL[^_]ÐU]UǀCǀCt ǀCǀCǀCǀCǀǀCǀDDǀHDǀTDǀ\Dǀ`DCu ǀCCC]UǀD]UD]U]UU]UUD]U $t$|$u} ]=X~tǀpYǀu ǀCdǀC1ǀCǀC(k=X+Ypǀu ǀCdǀC1ǀCǀC+kx=X+Ypǀu ǀCdǀC1ǀCǀC+D9 kǂpY؉ǀCyǀC1=,~y+@\pu ǀCQǀC8ǀCǀC+k&= ,+)npu ǀCQǀC8ǀCǀC+k&ҋ@9qǀpnW=Dǀpxu ǀCQǀC@ǀCǀC+k&ҋ)9ǀpn9Du ǂDDǀpx=~ ǂ=pC~u(ǀC@ǀC&ǀCǀC&ǀpxu ǀCQǀC@ǀCǀC+k*`ǀpxu ǀCQǀC@ǀCǀC+k*Dt ǀD؋$t$|$]U}u ǀCQǀC(ǀCǀC(Du ǀC&]U $t$|$u}EEEp EBw B~X~E)~E)~Uk,~Uk~Ukn~UkXx~UkEn~Uk2d~UkZ~Uk U;E ~E $t$|$]UUM EX~ k~ X~ E,~5~%~ǀCd]USE] UM=X~ kc=~ kQ=~ ?=,~ k-=~ =~  }9 O9~ًE~  ǂ 9p~cO~^pV9~ًE~3u~ !ǂ ǂ[]USE] UM=X~k=~ kv=~ kd=,~ kR=~ k@=~ k.n~ kZ~ B| 9~ 9}ڍA @w O~p[]UM Q DQuֲ<DQ<DQ0uղDQnDQo0uաC C SC C ш[^_]UWVS@RD$lD$$EE=DŽU M]EDžƅCS)Ѓ~p`p` C)‰SЋfff t Х<t<8~Dž  $P'gG2Í@w/Dž0 0$Pu $$=t$=fuJÍ@w;Dž0 0$Pu$$u#Dž0 0$P%u#Dž0 0$PX9T~;@|;@}VDž0 0$P܅c$u܅c~ $qX9T ;@}&;@}Dž0 0$PT;\}Dž0 0$P@t6ED$ED$4$*ꋅ)‰|F \$tD$ D$UT$4$ED$\$4$||t|IPx=xl:tf9lu9utC $3u퍅tD$ t$ED$|$-tD$ D$ED$|$ED$ED$Dt$ 4D$0D$| $á@HD$ t$t$$ Dut$$k9E +EDfYu)ƺ*),)ЍDD$$ǀDDD$$Ĭ[^_]UWVS|]EEU0fUEfEƀMuED$D$$ +C8S<S=S>S ?C`)¡4C`D$$u$3u4$0U T$ML$ D$]4\$u4$EED$D$$ +EEMT`uT0`DHuu֍ED$L$ 0D$ED$$EEĉD$D$$$¨UEE*mE)ƍvu)ƋMM$*)Í[)ËUE  T5EDu;cƀǀD$$'ufu$!f $"ft$$$ ǀtСƀƀƀƀƀƀƀUTuƀ)UD$$ USt&+tEuǀ'hh+toufǀ0D$$ܝ$ܝ$ܝ$ ƀǀD$$ǀh ǂhÐUtPǀ0ƀ'Tt ǀ4T%=u ǂ8;|(ǂǀ)+ǀ.UtPǀ0ƀ'Tt ǀ4T%=u ǂ8;|QuHD$$Q$ǀ}UVStPǀ0ƀ'Tt ǀ4T%=u ǂ8;|Yt$"=&tt$!f$#f,D$$ D$$u-$D$$Rtǀ3ǀ5ۃ㚁ül ʉ)9)؃Dƀƀl$ǀJ1ǀǀ@[^]UWVS<9|nuet3uu$!6$$(u$! $$| D$$D$$l@40),*)R)щ,4$t $D$0HD$,dD$(D$$t$ ,D$zD$D$D$bD$ JD$2D$$`D$$+D$$ ,lƀ  @D$$ fǀƀu+ƀǀ2ǀǀht<ǀ܅܅$D$$$<[^_]UtPǀ0ƀ'Tt ǀ4T%=u ǂ8;|du[t*t&t$!6$$(u$! $$tuult$D$$ ǀ.uǀ3ǀtgUǀǀǀǀ ;0 ǂ}Ӡ ǂ|ƀu+tƀ+ǀƀǀǀhUu4ƀD$$ǀ3UtǀUSD$$ǀ6 )Ӻgfff)‰ǀt[]Utǀ5VD$D$ $ `)Ѓ;(|ѡ  ǁ5U P%)‹()ЃD$D$$D$D$%$ǀU]u}tDD$D$%$ǀ D$D$4$ `)ЍX(9|[;uK9u;D$D$%$ǀgǁ 5[S;uBu +t"D$$&$!$! ]u}]UWVS ;@D$$T=?$tA@  ų)‰7@ ʉd$tA@  ų)‰7@ ʉdt $ ? ǀ@$D$D$$Ƌ(t?D$D$%$ǀ4u$! $!ftD$D$$5ƒ'~'`)z###!€+ttMu +t%D$$&$!$!t&Oxumuut&uNt  )Љ?ǀ@ (ǀ4 [^_]UWVS<;| t$"?t\$uGD$D$ $tt$"D$$Nǀ0ǀ8ƀǀ0),*)R)щ,<$D$$D$0HD$,dD$(D$$D$ ,D$rt$D$D$bD$ JD$2D$$$%`D$$ǀ,lǀ_>u ǀt)ǀ܅D$$$<[^_]U;|$"t#D$$MǀU`~KTtƀƀ)ƀǀ>ǀUtǀ0ƀ'W~)D$$ǀ-?Utƀ(Dǀ0ƀ'ƀ(T%=u ǂ8;|eD$$ƀ(ǀT$ǀ*ǀ@U~FD$$D$$kǀo@ǀUtǀ ǀD$$GD$$HtXt&uJD$D$ $tvt$"D$$D$%$$D$$Pǀl$ƀƀǀ@ǀ=ǀU;|\D$$ƀǀǀÐUWVS]{CCC s(FSSKщKcC S c9uËKKCCЉStACStBC tCCS %CC S{[^_]ÐUS]҉ y  Ƀ ‰ []UWVS Eu PPVPVV VVVVV DV$FV(HV,JV0LV4NV8PV<QV@RVDSVHTVLXVP\VT^VX@ F\э ]^`}cwG^dFdD$$эLf AD$$E [^_]U8]u}}E=*EGE܍ED$E܉D$E$G;E] GCG CGCWCD$T$$W,C(D$T$$GDFWHC@D$T$$ H @ D$T$$H@LfDPGTHD$T$$ thD$T$$ D$t$$ ff f$fuFlfDFpfFFtfHFxfJF|fLfNPQRSTXf\f^C `D$T$$@+E;E]u}]UWVS,} ]GECGCG CGGD$CD$$G,D$C(D$$FGDGHD$C@D$$ H D$@ D$$@HDLGPTD$HD$$ tD$hD$$ t$D$$  $uDFlFFpHFtJFxLF|NPQRSTX\^C D$`D$$@)EUT$UT$$EG-,[^_]UUǀǀǀ]UWVS,U(E؍REU܋U UEȍ}]ȃ~9~0u u9и#Ӻ)u9t)]|5WM]B9A~ 9utHG+EU苖R+U‰%E싆@ +E%E1EԋEE̋]ډ}̉NjMȉ)u}̉ËMȉ)UUЉ}̉EU(‹uE@EЃE}ЉEE)lj4}ЉEE)Ɖ4}ЉEUЉ(ЋMAMu9u)9ME+E ,[^_]ÐUE]UWVS)M)ȃ@0)+ȍxǀ$0Ѝ)])É؃@0D$$0Nj(,/~04D$t$D$ D$D$ $ML$F@D$D$ D$D$ $D$ED$4L$D$ ,؉D$(%D$$  Љ)مy@K=?~-@)0)ϋ ) T$ЉD$ȍ'$0D$]$E D$D$D$ D$D$@$ )É+E])ډƒ~3D$D$$ǀ[^_]UUȍǀǀǀčPD$$D$$USUЍE $f̍$[]ÐUǀ܍ƀǀfǀfǀfǀ]Uǀ܍ƀfǀfǀf]Uǀ܍ƀfǀfǀ f]Uǀ܍ƀfǀf]UEƂǂǀ܍fǀfǀfǀfǀ ffffWǀ܍fǀ~fǀ{ ff]UWVS}܍uĉt$$dD$ t$܍D$$tg܍fb܍~8b~  f#Kf1DK9uӋ}b܍fE D$ D$dD$G$ļ[^_]ÐUƀƀǀ"]Uƀƀǀ"]UU]UWVS׉΋UBljM fM 9u[^_]UWVSljUMƃT$4$EA9sEpfB9wE7[^_]UWVSuF T"pNFV ЋFEt&EE uyM%A%A%A%MtMtMXhؤD$ED$A$ؤPؤ9s f99w]XD$\$$E8Mؤ"uUU, EpD,wMpD,M̟ПtEMMuؾ~3D$ED$A$Et몃[^_]UWVS@  p ~b t$$ED$D$D$ D$D$$ED$ $DžB̐~fJVD$4$$D$XD$B̐D$ D$D$4$"$D$$Dž܍Dž+ɉDžt$ Dž ~[9)ƿ@9v6+㋍@ǃ9rf~c; )ƿ ; s6 +㋍ ǃ9rf 1u)ɉEEE H ‰9|+DžDžfDžfDžQDžDžfDžfDž‹9v ff)9+؉9|jډ+Ћ UWVSl] }D$D$$N3$ D$$0D$$0 !㟈\$$D$\$$s D$$D$ D$$1t#D$T$$9~‰)9ΉtD$4$D$4$l[^_]UWVSLEfE} t 0\$D$$ T%uuft x)C D$0ED$,ED$(~,D$$~8D$ ;D$;D$f,D$~;D$M,D$ EމD$T$;$Et7E9~ƺ$~ pܺE))Љƒxt Ј;t-x$Cx$fCCC C` ЈCtcKt/C?C ЈCC@CC?C E EL[^_]UE `$ǀǀǀǀUU@t>u;eƀǀD$$'ufu$!$"t&t$$$ ǀtСƀƀƀƀƀƀƀƀƀU\uƀ)UD$$ US;t/u&T$"D$$:$``$ǀǀ >,2)ЉMb)‰[]UWVS MuQ QQPQTQXQ \ uiA$liA$lV U hǀ@VFVDVEVHfVJfV,f>,ǀL`ƀ;_@t fǀ _ t8F*f)Ѓ.f)ff9} f~fFFFD$$fǀ@f+fF*f)҉$F*D$$ [^_]ÐU~#D$$0ǀU;E\tƀƀԹED$$D$$0ǀ~ǀUD$$ ǀ+ǀ@ǀǀǀU;|M\ t\tt&ǀǀU~,\tǀʀǀUVS $)‰T$$$)É\$$ $))o $R \tfyǀǀ[^]U~s$)‰T$$ |tƀԹƀǀǀU;ƂǀD$$ǀ8ǀ0ƀ'ƀ%ǀǀ>ǀǀpU;| $R pp;tfǀ0D$$ܝ$ܝ$ܝ$ƀǀD$$ǀp ǂpÐU ~%ǀƀ,ǀ]U~ ǀC]Uw~;ǀ0\%=u ǂ8ǀ]U;| ǂ]Uǀ~]U;| $R D$D$$D$$}ǀ^ƀD$$GD$$Hƀǀ@ǀ+UVS;| $R D$$ƀD$$ ;W؉$~,T$D$$~8T$D$$N,T$D$$f,T$D$$"L,x f<,~,D$N,D$$ƀǀǀǀ+hr *)R҉ )Í[)É0)؉$ǀǀǀɈǀt[^]U;|LD$$Xǀ1`ǀU;;t@ǀ8ǀƀǀIƂ}ǀ\tƀ%ǀ0ǀǀUS@$)‰T$$ 9w 9v3$``$ǀ []U~}ƀ, |u'ǁƀ}ǀ[@xt Ns N9vǀ[ ǁCUǀ{$ƀƀƀ;U.~u$ƀ\%=u ǂ8ƀ'ƀƀǀ%Ut#t$ƀOF~+\%=u ǂ8ǀoUt#t$ƀ.~=ǀox~ǀ8ǀ0ƀ'USt#t$ƀ/u;]ÉD$$"f9} f~f_tv?nƀ;ƀ/l)ʉll)ʉlfǀ0ǀ[]USt#t$ƀ];ND$$\$$ƀ;?$R 7ǀ"ǀ0ǀ[]UD$8$`ǀU~>D$8$`ƀǀ}ǀU(Et#t$ƀ;| $R =w;=_mD$D$$D$$KD$$n     t ;@"ƀ;ƀ;ǀ;D$$D$$\tǀ$ED$$D$8$0$ ǀǀHǀUD$8$0$ǀUVS ;| $R EƀǀD$$ǀ8ǀ0ƀ'$D$$L0+*)ƍv)ǃD,ǀ;t[uR~,D$f,D$N,D$ L,D$xD$4$ǀ4$ǀ [^]Uobtw$$$$t t $!ǀbUǀU$ǀUVSf,D$N,$L,N,O,R,P,Q, S,щL$$uǀW[^]U$ǀǀUSxxD$$ǀٕ[]U~,D$~8D$$` $|f<,ǀKUS$;D$ ;D$~;D$N,$M,;tH~,D$~8D$N,D$ L,D$;D$M,$;ǀǀ4,ǀ8,$[]UD$D$8,$~8,A-8,;4,}$R 8,ǀU(]u-ǀt$ƀƀǀ >ǀƀǀt-*)MIEEE)I9Eu9D$$$ǀ$D$$D$$]u]Ukl9|#ǀHǀ,U$f,T$N,$~,$ǀKUD$$ ff ҉$ǀ̄ǀǀUWVS 9s 9wL,uvT Q~,Q~-fQ~,ۡfP~-uL,9 ǀ0ǀ녃 [^_]UKƀƀƀ;ƀ8`$ƀǀǀ8ǀU;|xǀ0$ƀǀǀǀÐU`~:\tƀƀ)ǀǀ]Uu0ǀ€>ǀ۝]U?~ ǀf]UtPǀ0ƀ'\t ǀ4\%=u ǂ8;|(ǂǀǀ.U;|6 D$$ǀU;~,t#D$$ǀUu#D$$ǀ}UStPǀ0ƀ'\t ǀ4\%=u ǂ8;|#t$" $b )D$$"D$$~#@ǀ D$$t ʉ)ȃ2~3Dƀƀt$ǀ@ǀǀ@2D$$ǀ#ǀ@[]UStPǀ0ƀ'\t ǀ4\%=u ǂ8;|#t$" $b (D$$D$$D$$~ =۝uD$$uD$$ǀt ʉ)ȃ2~3Dƀƀt$ǀ@ǀǀ@[]UD$$ ǀǀǀUS$]\$D$$\$$t$ $ #@t ǀ#Ht5D$$ǀǀ ǀf$[]UuǀlUS$ƀ  ƒ(( @D$$ $]\$D$$\$$ǀ/ǀ$[]U?~C$D$$ID$$ǀUH]u};|u $b ^D$$#@tǂǀ=$D$$t@<0)D,*)R)щD,<$D$0LD$,lD$(0,D$$|$ D,D$rt$D$D$~,D$ f,D$N,D$$ƀ`D$$;D$$ ,tƀ$ @D$$ fǀu+ƀǀhǀǀptǀ܅]u}]Uu #@tPǀ0ƀ'\t ǀ4\%=u ǂ8;|#t$" $@!ftluct$"D$$~ǀtCǀAǀUǀǀǀǀ$;4 ǂ}Ӡ ǂ|ƀu;tƀ+ǀƀǀǀpU;|u $ D$$Nƀƀƀ.,ƀ&$ǀǀuǀǀNU;|u $ t#D$$MǀWtU T%)‹@,)ЃD$D$4,$ǀU]u}4,8,D$D$4$ `)ЍX@,9|(;4,u9%\4,T;4,uCu ;t"D$$&$!$b 8,]u}]UD$D$8,$ `)Ѓ;@,|ѡ8, ǁ UWVS ;D$$T4,4,=?e$4,4,@ 4,4,ʉl4,4,4,b$4,4,@ 4,4,ʉl4,4,4,<,4, 4,4,? ǀ4,@D$D$4,$5ƒ'~'`)z ###!€;ttMu ;t%D$$&$!$b t&Oxumuut&uNt4,8, 4,)Љ4,4,?ǀ4,@4,8,@,ǀ [^_]UWVS<;| $R D$$Nǀ0ǀ8ƀǀ0)D,*)R)щD,<$D$$D$0LD$,lD$(D$$D$ D,D$rt$D$D$~,D$ f,D$N,D$0$ƀ1`D$$ǀ,tǀ0&$tǀ܅<[^_]U;| $R t2D$$Mǀǀ Utǀ0ƀ'W~)D$$ǀ Utƀ(Dǀ0ƀ'ƀ(\%=u ǂ8;|eD$$ƀ(ǀT$ǀǀ@UtPǀ0ƀ'\t ǀ4\%=u ǂ8;$D$$ƀƀƀ.,ƀ&$ǀ8Uu6EEED$$ ƀǀUUt`D$$ $ǀǀ>ǀÐU;|$R tU=?~a-@pp~9D$$D$$ǀpt ~m~3~.ǀǀ~ ǀǀPD$$D$$~?$6D$$*D$$&$!uǀƀǀ;tB;ƀ;-uL ǀM$tz;uqP thHtVD$$D$$ǀƀǀ6ǂ(*u' ǀ(uAD$$%ǀǀkt7D$$)ǀǀ+tUD$$)ǀԺǀǀ0t7D$$/ǀǀt4D$$.ǀǀPtǀǀ)t D$$&$!UƀƀǀǀqƀǀǀU~J D$$ǀUƀD$$0ǀ8ǀU~/D$$0$ǀUD$$ $ǀǀ2ǀUt~D$$$ǀǀǀǀƀƀǀ?~ $"UStD$$,Mt ƀD$$($~VD$$*$   tpD$$*$⋃ttuY ЉIt@$;4 4ǀD$$+ƀ+;ƀ;;t/ƀ;;t;tjcƀ;;_t;_t";\%$ǀԺǀǀдt^u$$  $$fu $[]UH]u};| $" t-D$$)ǀtD$$D$$ƀƀǀ0)D,*)R)щD,<$D$0LD$,lD$(D$$D$ D,D$rt$D$D$~,D$ f,D$N,D$$ƀƀƀ.,ƀ&$ǀ@ǀ]u}]ÐUE$ԳUE$гUS$]xD$$̳E D$D$`XD$ D$D$$XD$X\$$$[]UVSĀ]u t$$D$t$$ut$D$`سD$ D$D$$t$$ȳسD$X\$$[^]USM]Uijuȳu̳UгD$ D$D$$ǀԳسD$$@XD$$@[]ÐU]U(]u}]u { GD$ED$4$ED$CD$|$ CD$D$4$|$4wt$$]u}]UEP T$`$UUE EBEB$ÐU]UWVS]}} 7C D$CD$$Uf CCSt>r&uf{fCC|$ D$D$${~f{bCCO=~2  у ) D@) D$D$$K ƃu㍆ f  ƒ   ҍT@։~0 ut;}Cf{uCCum t E=v[^_]US]CCǃ ǃǃC D$$ \$$[]US]E D$ D$D$$$[]ÐU]U]u}UB ;E ~k+} F9|:)x/EF7]FAB9uEFD$D$<$b;E }]] )ËEF9}FT$D$)؉$ًUFF)ЉD$D$ $E ]C ]u}]UWVS,}_E Eܾ+u \$D$4$+]܁@#\$ED$U $P#\$E؉D$4$+]܁@#\$ED$E $FJ+G )+E E~2GP#E@# E9u} qEWUFJ+G )+E UE~3E荔GP#Fƃ9uE+E UDGfE昉)~ EfP }UEfP UEf PUWN# U)‹FEGN# ‰U}t`EffwR~NЃpdUщʉƋE荔GP# F9EU9U }tNED$U $$ËED$U $~ $)ЋU  E ,[^_]US]CC CD$$P#D$$FD$D$$ǃJ[]UUE EBEBEJEF$ÐUE@]UEU UfP@@ $U]UWVS }u Ur9uO9~)ʉG)ʉ GG$Gf9~f)И$ȃ [^_]ÐUU E]UE@]UWVSuF} ~yU)‹E ‰} EUVVˋ}OЁ1)=`m~ EFEUZF}f_9M uEF[^_]U]ÐUEM uǀJ\w @J7=ǀJ@JuǀP_w"@P8ǀPIP]U8EpEEE EE܉$UWVS5E D$D$$` 9r )ȉ(\$ JD$D$`\$T;XE D$ \$D$`($;X~l=~e=^TT+XD$$TT$<$D$$ED$TD$E D$ (\$D$`D$ht$\$ D$ED$$`ED$TD$E D$D$ t$D$` $D$D$$ǀ}t<$49~4)ʉ44~888~ 8ED$|$D$(D$ E D$D$`<$8~>?u5E=+J]-$ J]荵t$D$`G$ЉT$\$ t$D$`G$(t$ \$D$`G$TD$D$E D$t$ D$`D$$ ij9r )ȉE[^_]US]JD$E D$$؃[]UWVSl5+y`Äu `9|XЃ)ij9sAD$$E D$D$$0` ij9r )ȉ(\$ KD$D$0$ED$D$E D$ \$D$0$t$\$ D$ED$$0ED$D$E D$D$ t$D$0¬$D$ D$$Nj5?9~?)ʉ??~???~ ?ED$|$hD$(D$ E D$D$0?$?~@8u7E=-P]-$ Puh\$D$0h$ЉT$D$ \$D$0|$ )؉y`Ƅu `9|rЃ 9r )ȉD$$D$$\$ D$D$0$D$D$E D$\$ D$0D$$` 9r )ȉ]\$E$E D$ D$\$E$l[^_]U]uu] \$4$KD$\$4$]u]UXTD$$($UWVSu} ]0E(= ~ E,= ~ \$ D$D$$\$D$D$ D$D$$$ij ЃijijD$$U <-=D$ D$D$@$D$D$$D$`D$D$ D$D$$ǀ?ǀ?D$D$D$ @D$D$?$D$D$h$D$|$D$ D$D$@$ ЃD$$>TT-=uD$$XT+XD$$D$ D$D$@\$D$D$D$D$DD$D$ D$fD$ $ǀ4ǀ8D$D$D$ @TD$D$<$D$D$G$D$G$D$ D$D$@G$D$($ǀPǀJ[^_]UUu!D$$(uD$$UUltmt)ku=6B$$BD$B$ $Ut   ]U]UWVS,}E8҃UT$ D$  D$|$E $E]u \$3D$`+E $) D$ED$U $ML$U D$  D$E)) \$M $E79t#1)9~΃9uƉEM ǹ},E M9}0E J)‰‰ËUf =M fM)‹]MMыEf U  },o= ~)؃M 0=)Eǀ DU M Eǹ`m~KU ti`mU i`m‰U E t M E,[^_]US]CD$$`ǃ ǃ fǃ fǃ fǃ []UEU U $ÐU]UWVSE ]} +u \$;D$4$)"D$ED$U $E)Á \$$$f]"\$D$4$)"D$ED$M $E)Í |$$$f]f;"Mf;DU DD$DD$ D$t$ $] DD$DD$ D$\$<$\$t$U D$Mf;D|9U DDf;"| ǁD~U [^_]US]CD$$"D$$ǃD[]UUE EfDEf"EDE D$ÐUVSuU r9u[^]USU] M/9$))щʉ[]U]u}uE D$E$~ $Ǹ;E~+EM)‰‰ËUf0M fM)^‰MыEfUʉ]u}]UWVS \$ED$E$}ESЉ$fuǃ9uuNjUU}ǹV)9Uu $ft }fkE D$U$WfM)U fJ9Mt!ًUU}ǹ| [^_]ÐUU EP]UE@@@@@ @@]UE$UUz u z ~ z]UU EP ]U]U]u}]u }ED$<$‰D;3tEu { N6&u*{@B&~)D9~3CD$t;3uED$ED$<$ED$<$]u}]ÐUlPLlXTƀ]U`\hdƀ]UU]U $t$|$u~  h+duƁ\`)Ѕ9ƁiM   9u9u׋d\d9udd$t$|$]UWVSM] X9TuƀwPE2U<9Ë l9ul9uԉP9Eu lEE쉂X+Ey[^_]UWVS} \`)Ѕ;E EƁE5Ƭ9t))99u ¬9u\E[^_]UWVS} PL)y;E ƁEE5l9t))99u l9uPE[^_]U\+`y]UL+Py]U`+\ƒy]U`\hd]UlPLlXT]U8EIEE܉$UWVSLM h9d`E:UuΉE9t-}u%ECEEЉ$E9u9u`9Eu EEh+]yd;hu tƀ؃L[^_]UWVS } X+TuLP)Ѕ9\M   l9ul9u׋TLT9ulTTtƀ [^_]UWVS } LP)Ѕ;EEbEl9t))99u l9uLtƀE [^_]UWVS } `\)yu E~;ut&uE5Ƭ9t)):9u ì9u`tƀ^E [^_]ÐUU ǀ$ǀ(ǀ,ǀ0ǀ4ǀ8]US]E D$$$؃[]UE D$E$(US]$,$0[]US]E 9t)9u[]U8ECEEE܉$ U8EDEEE EE܉$ UX]u}];CE^EԍEЉ$ {{suC wuC tu t&Cuu,"uuwt.f@&C u7ǀ0ǀ(ǀ8u7ǀ,ǀ$ǀ4ǀ0ǀ,ǀ(ǀ$ǀ8ǀ4:t$|$C$C u7ǀ0ǀ(ǀ8u7ǀ,ǀ$ǀ4ǀ0ǀ,ǀ(ǀ$ǀ8ǀ4At$|$C$!C u7ǀ0ǀ(ǀ8u7ǀ,ǀ$ǀ4ǀ0ǀ,ǀ(ǀ$ǀ8ǀ4H D$ t$|$C$C u7ǀ0ǀ(ǀ8u7ǀ,ǀ$ǀ4ǀ0ǀ,ǀ(ǀ$ǀ8ǀ4@ D$ t$|$$AC$C u7ǀ0ǀ(ǀ8u7ǀ,ǀ$ǀ4ǀ0ǀ,ǀ(ǀ$ǀ8ǀ4'$8u$4]u}]ÐUMU TUX\`ƀa]UE D$E$TUE8-uxuP\]UWVS u] <\$4$XtC`ƀa9t&au$ƀa\t`9s)ڈ 9u [^_]ÐUWVS]U dUh؃t؃`~tnxxtFtpGtppكfl _p؉艂ǀ ǀ|ǀǀǀƀƀǀǀǀǀ[^_]UMt tD;r%Ƃǀ ǀ|]UU:ucƀB~- wǀ ǀǀ]UWVSEE ` t+E M  9E+Pp]ĉ\$$h d95xtf>})Pn":t f#lfUd;PuȍUd8Eĉ\)nT+!҉1Љ1ȉ1 t l!f]d9u]dUĉX)nL/!ɉT1ȉ1Љ1€t⋍T l!f}d9u}dW})Pn":t f#lfUd;PuȍUdddR9t! |p- ||ǀ|U |`)9aEĬ[^_]UWVSLEE EEEEUĉUEME < ʉ9u8u<~uE}w񀻱ti ǀƀ w ǀ D$$ u$ƃǀj#;(n!‹EExtyMtt t=fu41Љ1Љ11Љ1Љ1ƍ E9tEpӫp) !ڋ9uAEQǀ艃;hEE+E ;Elu$}t $}t $}t $UE(ЄtT$$dEL[^_]ÐUMU UU@ǀė) ǀȗǀ̗ǀЗǀԗǀؗƀܗ%=@t/=@wtS=t,=uD3ǀ1ǀ ǀǀ ?y ǀTTݗǀޗƀ%tƀ ƀ~ǀNƀ*ƀ+ƀ,ƀ-ǀ0ƀ6ƀ8ƀ9ƀ:ƀ ʃ? ƀǀǀǀƀ'ǀǀ ƀ$ƀ&ƀ(ƀ)ƀ4ƀ5]UMƀtƀ ƀ~ʁt|ƀ$ƀޗƀ$ƀޗƀ*ƀ+ƀ,ƀ-ƀǀ0ǀ 45ǀƀ6ʃ7ҡ('8ƀ9(t ǀė;  ǀė @ǀ̗ǀЗƀ)]UVSuE \$$ėu[^]UStttt& =L=h==&===]==t&=t&-==t&)===v==t&=v==t&AAAAAAAAA}Au]AmAeA]AUAMwAEA=<t,<w <ut&\<tv<5<<<z~2IAAY5<9ӍA<A<<x<t2IAAY<9ӍA<Aǀ(=,= [^_]U8EFEEE EE܉$<U8EEEEE܉$<U8EEEEEE܉$<U8EEEEE܉$<U8EEE EEE܉$<UMU <tT$ $%<tT$ $ P T$ $h<UMU <tT$ $%<tT$ $$P T$ $l<U]uu] \$4$…\$4$…us$<t2<w)\< `<~\$4$…u3\$4$…u!$<t\$4$‰Ћ]u]U8EEEEE$ EE܉$<UUS]9x<sǀ<ǀ(< x< |<[]UM!x<!|<x<9v)t ǂ<ǀ(<Uǀx<ǀ|<ǀ<ǀ <ǀ(<ƀ<Uǀ <ǀ$<$ƀ<<D$$<D$$<D$$<D$$<D$$<D$$<D$$<D$$<D$$ <D$$ <D$$ <D$$ <D$$ <D$$<D$$<D$$<D$$ <D$$ <D$$ <D$$ D$$$t&USMt6tEu@Ygfff)‰T$A$AD$A$[]US]$<t$<t$[]UXEEEEEEE$ƀ<ǀ<p<u $$US]<tE D$$؃[]USUAA t= f^Cz<B$t{ ډ\<^B$tM ډ`<0zu*Bgfff)¡d<[]US4E$t ډ\<E$t ډ`<Egfff)¡d<Uh<U l<Up<U t<p<tƀ<ƀ<ƀ<ƀ<ǀ<ǀ<ǀ<ǀ<ǀ<ƀ<ƀ<ƀ<ƀ<p<%@t6@wtM=t&t,=u;&(ǂ<t&"ǂ<ǂ< ǂ<P=4=U=<==D=[>L=D$l<D$h<D$ D$D$$D$$l<D$ h<D$D$ D$ D$D$ D$D$$p<%=t-=wtB=t%=fu2&ǂ<<f"ǂ<<Kǂ<<, ǂ<< p<% =t6=wtK=ft,= u;&(ǂ@<t&"ǂ@<Kǂ@<, ǂ@<Xp<%0=t6=wtK= ft,=0u;&(ǂH<t&"ǂH<KǂH< ǂH<p<t5ƀ<$<T$p<$4[]ÐUWVSEס;;Eƃ]:9u;M9uݡ;E[^_]US]U []UWVSu }ƅS;3;;;uoA;u_;uOA;;;;;ǀ<ƀ<<<~ Ƃ<v;;;A<<;uB;u8EEE;E<EE$;ƀ<;f;;f=t f=SDž\EDž`\$;EEEEEE8E$EEEEEEE$ƅS;;)9EĬ[^_]UVS`uU ;ǀ;ǀ;ƀ;ƀ;ƀ;ƀ;ǀ;ǀ<ƀ<ǀ;$ǀ;$EEEEEE]$EEEEE3E$ǀ; ǀ;)ǀ;)EEEEEE2]$EEEEE7E$`[^]UEEEEEEE$EEEEE$;UWVS u } ;3;;;;f;;;=t#=u/$fǂ=vfǂ=fǂ= fǂ=f=v fǀ=s<f=ƀ=00u$t= ƀ=t<0 f=t< f=u<f=v<f = =t<f"= =t<f$=f=v fǀ=f=v fǀ=f"=`v fǀ"=`f$=`v fǀ$=`ƀ<ƀ<fǀ<fǀ<ƀ<ƀ<ƀ<fǀ<fǀ<ƀ<ƀ<fǀ<fǀ<fǀ<fǀ<fǀ< fǀ< []U]uƉ:<tD$L$4$؋]u]U]uƉ:<tD$L$4$؋]u]UtD$T$$U]u}]u <9~D$t$$D$t$$<<<3:<u;@=D=)19u<ky<tb$9@=t$;$-D=)81u؃9u$]u}]UVSEu <t$y<t$<u$i<9~A@=D=<D=@D=2D9u$[^]U =$@U$ U$ US4U :<E<t =<<t =<< =f<<=f<<=<<=z<<"=<<=Cf<<=#f<<"=<<=f<==f<==f<= =f<="=kf<=$=Kf<<tƀ<<<@<t=D$l<D$h<D$ <D$<D$$<D$$l<D$ h<D$<D$<D$<D$<D$ <D$<D$$7y<@*E<T$<D$$$@<t<<t<<t=D$l<D$h<D$ <D$<D$$<tiD$$l<D$ h<D$<D$<D$<D$<D$ <D$<D$$fǀt $4[]UEU tD$T$$5t&<t$$U$$U]uu] C<ډ%tDډt7<t$<@ <]u]U]u}u] {ډډ tr<t"t x<tN$f9t5x<t$ t$]u}]U]u}u] {ډtSډZtFt>x<t$ tt&$ ]u}]U]uu] C<ډfډ tv<tB<u <t<$9<@&y<t <<@]u]U(ǀx<ǀ|<ǀ<ǀ <ǀ$<$<t=D$l<D$h<D$ <D$<D$$<tiD$$l<D$ h<D$<D$<D$<D$<D$ <D$<D$$U]u}U] D$\$$ <~:<t$u{D$\$$Fs@tD$\$$<%9s{y @tD$$<ǀ0=4=<4=@4=<`B<ls`tD$\$$HtD$\$$-y<t$<%9t $]u}]UM y<1<$<4=@~~ǀ0=ǀ0=4=<@B<<<4=<4=HEt r,ul4=@ C4=@@24=@<:<tƂ<$ÐUVSp19u[^]U<t2<D$$<$…uҲUWVS } <[<N<:<s <<:<s <<:<s <<:<s < <<)<9~< <<)<9~< <<)<9~< <<)<9~<<<C @:<s8u<tƂ<ƀ<8<w8<vA<8<w8<vA<t@<<G  G,<u$ۍvt<<<< [^_]US] x<|<@tH@<=<8=|<8= t/ b<C|<at/.<CS|<-t40=|<0=t4@=|<@=ǀ$<<<tC+<tƀ<ƀ<C C<C|<%<@t?<=<8=<8=yD<C<tCƀ<<@tA<Cc<tCsƀ<<Et+0=4<0= t(H=<ߡH=t+@=<@=ǀ$<<S<C<tƀ< <tC7<t*<ƀ<ƀ<C C<[]U]u}u<<x<<<<tE{u9{u1C PCCU ǀ$<Cwu <9R<D<\<~ `<~"8<u<w `<~9~C D$$ƅu$<<$á<D$$CFCS <S <BC P<<CU 3 <u$ǀ(<ǀ$<C]u}]U8EGEEE܉$(PU8EGEEEE܉$(PUWVS]0R4R)y9~߉)0R}E9} )‰UE}EEU )19uM ١U䉐0R0R90Ru 0P0R}t`0RE؉E)9uU0R0R}90Ru0P0R}E[^_]UWVSM8T+`ThT_hTLTLTw]USá;HTr.mDTѠHT9HTv[]UWVSǀXTX;XtSXTu9u XT9u pT} AXTCXX;Xu|TXXtTU |XXt3Xu*XXkǀXLTtBDLTt hTǀLTǀhTƀXXTpTXTEE[^_]UWVS<} EE]XwML$ED$XD$ D$|$$uǀX]ƀXQXǀXtTu:XutTu X3ML$ED$XD$ D$t$$EM))щEEtTu;u";uW49u;)2:Xu 3X9tܻ)33:XuoX39uɋALTLT`TLTE<[^_]UWVSu} |XuPTǀXT/XTXTCX9XT X;Xu|TXXtT;xTXt3Xu*XXǀXsLTt*hTǀLTǀhTǀtT$RpTXǀtT$ǀLTƀXEztTu%U)dTs]t~ tU)‹TTua|VD$$XTTTTlTTTu'XTpT|$4$ED$|VD$ $¡\T TT9tE)ЉTTTTt|VD$ЉD$A%$\T=vY;`TxTi\T`TdT艃dTǀ\Tǀ`TXT9s }lpTXT[^_]UX$ǀXǀXǀXǀDT ǀHTǀtTǀxTǀ\Tǀ`T|TXXƀXƀXǀdT$ǀPTǀTTǀXTǀXǀLTǀhTǀlTǀpTUUXU XUXÐUSzz9)ÉD$$z¡x9t`zzz)xD$T$C%$xzzzxzz[]Uz$ǀzǀzǀzǀx ǀxǀx$ƀzxzzƀzƀzǀzǀxǀxǀxǀxUWVS<z;zuxzzE E9E IU ƅ}tU:~ ƅ$uz+z_zz)ӉT$$z¡x9uCxzz+E EUxzzz)xD$T$C%$xzzz+E EUxEx6ztqƂzE<t*<r<uD8ǀx$zUz3 `$t&JM8zu Ƃz,zzED$D$zD$ D$ED$$uzǀzƀzEzǀzxxxx;xYx#xxӪxx)xtKr Oǀx$ƀzǀxǀxxx v $Ѡx5UT$zD$ \$D$$z<)L>:zu A3zzz9uƋ9UxE<[^_]UUzU zUzÐUWVSuEfeE%EMEfeE%EMUE)Ћ]}$ƒuUff&NUM 9u[^_]UWVSDEEE EUU܋M$M]ECESŰKMЋS []ԅuU EU E}tM M؋]]EE9]  M M]]EEǃE9UM]܍<y`gUfGf% fGE̋U܍Mfʁ% ЉCf% fCK@;GfƁMMEf%fEE%E]̋E܍]E܍ %E8]w|8]u;uuU9UuGf%f EfG]ȋU܋% E]% ЉUfCf% fCcduA@uXaÚ% ЉM̋E܍U% ЉCf% fCK@KULj9]u]ESyމ+E܉uM̉MЉ}C@u؋%E܃E@@t%MAf%9u(@tIef%Qf fQH]܍ %9t]܍ E%9u@tI@% Љ&NẺEЉ}EUMMEǃE}]9]EMA]̉YEЉAQ }tM؋U }tE+E])ËUE+ED[^_]UWVS,} EEuE}tUE]E}vFu$ʋ%E EB@t}wӍED$D$ED$ ED$CD$$E=vu$UB9}:}tEU+E,[^_]U8EmEEE܉$LU8EmEEEE܉$LUE D$E$UE D$E$US4HtHtEPP=/uvl-0uPEmEEE]؉$LEmE@EDE$L4[]UU,LUHE(D$ ED$ED$E $E$D$ E D$ED$E$ǀPÐU $t$|$lj΋Mt,t(:t ;:3ut u؋$t$|$]UWVSƉ׋EtP0PEM :viP0PPPu ǀPPwt P0P[^_]USúдƀ[]U9t PD$ȉD$Ȱ)ȉ$))İ)ȰǀDŽ̰uǀ̴ǀдǀԴ@ǀشUWVS ȰPD$(P)Љ$,PȰu Ȱİİ;0SP̰ER̴; PAд̴Ƅ̴̴DŽԴ̴DŽشP̴̴̴̰д̴Ƅ̴̴DŽԴ̴DŽشP̴̴̰IEEAEEP}д)̴$R̴9uA̴̴E싂ԴVUUEشtE 9S} ̴; P д̴Ƅ̴̴DŽԴ̴DŽشM̴ش̴;l̴д̴Ƅ̴̴DŽԴ̴DŽشP̴̴̰P˄kдѠԴu;ԴsϺYдEFƀ ̴; PU9$P д̴Ƅ̴̴DŽԴ̴DŽش U̴ Դ̴̴дP 8))4$Ë $Pu09v)̴uw!C w"t&CkK$P.wl;NwY(=wD=w /ƀ!شuǀشuشƀ;u,Gt&)¸KPc;(PuFǂǀǀİǀȰ;vuZƀQuHtt)¸xƀİǀǀU;Դ[^_]UWVS }u tuPCEP0PPPu ǀPPE;}t PEPƀƀ$ǁPİ;ȰtvEPEİPܴİ8uEܴ3~İ;Ȱt Eİ;ȰܴFEǀPǀPǀPǀǀǀİǀȰǀƀƀƀ$E-UЃ [^_]UU PU $PU(PU,PǀPǀPǀPǀǀǀİǀȰƀܴǀƀǀǀƀƀ$ǀǀYÐUWVS}tx wf]    u ǀ 9t w뢾@[^_]Uǀǀǀ ǀ$ǀ(ƀ5ǀ8]UWVSljȋ+09É)к)‰0 0  *0X8rǁ0u ǀ8u![^_]UUU UUǀ ǀǀ+ƀ,ƀ-ǀ0ƀ4ƀ<ƀ=ƀ.ƀ/$ǀ@ǀDUWVS, u ǀ-teƂ-truAtƀ/f,,35$':,u Ƃ-f.ut;9t0 D$)ȉ$D.uf;pǂǀ/Eƀ.$ƀ/=&;Ƃ=0E܍ED}<t9ƀ<$;v$ A$$E]w5ƀ4 ":%ƀ4 9~4ouL}Nu|-ƀ<(u$ ((E]ƀ4;}Et&BEtXutp}utZ].v Nv=v =҃ҍEt ] XU܉0 ;r$5u9Ƅ  $ <o8 ;PF  $ *ƀ.$0b(ҍE]K08(ҍE3!ƀ<ƀ= 7;w>:D$$)TT$4$  $/95uE;<u8 U$)Ѝx$ED;wRT$D$U$U.$P$: ;5uAƄ   )ȉ$ <8 ;F   )ȉ$ l8$D19u ;r$58 ;;  $ t=u . 9D$)Љ$Dx<f58Hƀ4 ;M,[^_]ÐU<<< <<0<<4<<$<<(<<,<<8< ;u#;R;;MbB<< ;t=`s`H< ;u?;;D;i;0;¸MbB@<;u ǀ@<@@<D<D<='v'L<L<=sL<<<P<=sP<@<T<=sT< ;;MbX<ЃdsdX<]U8EPEEEE܉$<U8EQEEE EE܉$<U8EDEEE EE܉$<U8EPEEEE EE܉$<U8EPEEEE܉$<U8EPEEE܉$<UUdStu Ѓ؃$UhSt$hShSt%dStD$d$hSdSt tɐt&UE<Uǀ<ǀdSǀhSUSU 6$B$tzډ;B$tzډ;PzuJkR>;4ƀ;&ƀ;ƀ;ƀ;[]UMtEPtuGt&AD$A$'A hShSUWVS ]U;U;;ƀ;ƀ;E $tz;E$tz;kU>;؃؃;؃;;;;;%==w(==vta:==t&w=v==t&ǂ;@ǀ;ǂ;@ǀ;ǂ;@ǀ; ǂ;@ǀ;@ǂ;ǀ;jǂ;ǀ;Oǂ;ǀ;4ǂ;ǀ;ǂ;ǀ;;`@t8@wt u:`u-'Ƃ;Ƃ;Ƃ;Ƃ;;%0=t/=wt;= ft"=0u+&Ƃ;Ƃ;Ƃ;Ƃ; ;;ƃ @9vÈ;;%0=t.=wtB= t%=0fu2&ǂ;f"ǂ;ǂ; ǂ;0u;%=@t6=@wtK=ft,=u;&(ǂ;t&"ǂ;ǂ; ǂ;p;%=t6=wtK=ft,=u;&(ǂ;t&"ǂ;`ǂ;' ǂ;6 [^_]U $t$|$@Rt#;*T8 I;R$t$|$]UR]UVSu] $¸tm;8vB ;tBB J BB B B B BJBBT$$[^]U]u}<uL<t<+,<9re<;9}KD<t<+$<9r7LSt.<<*;9~<t D$;$t`ƀ<ƀ<t UD$;$<$<<,<]u}]U]uÅtx u\$‰$]u]UD$ $D$$D$$US] < <:;ut$ƀ << D$$ D$ $< <[]UWVS;EE ;tzu!zzu ztT$$| E8t(;EE;tzu!zzu ztD <T$$< <$…}CEЉUҸ !tA$ ÅtD$$;:L ÅvtJx uD;:T u+D$ $\$$sUwtbD$ $$ÅtD$$;M:L uˆ<;ƀ <}t*<:;tm;G$<:;tC@<t9<+ <9s)tx t;$[^_]ÐUS]$t/@@@ @ @ X D$$Ѓ[]UVS];$tv@@@ @ @ <Q <A AY <uL$$L$$u[^]US<8 <t"‰$t< <Rtx u$Åu'StZx uT$ÅtBSt D$d$\$${u[]ÐU TTT]UT;Ts!TTT]UƀT]UY]Y]ƀUʡTƄHUHUuΡƀ]ǀ][][]ƀWfƄHWQHWu١ƀ]ǀ]ƀTƀT]UVSu E ]td])Љ9~Љӣ]](ȉơ]u]ƀ]u[^]UUtt]UWVSE8YE8Ps QQf8PrE)]AfyՋM)([^_]US¡]ue YYBY$Y8u$]tu tЃD$ ‰$[]UT<v ƀT]tLD$ $]]tƀ]RUǀTUTPT]UVSuUYTYǀTU T];]uVY]Y]YD$$;… ]]]ˡTuTT<w/:TtTƀT TMC:Tu4S1$|S|Su St|Su W$t&ÅtxD$${ uT <wFڸu$ <<0<$TdStF(Suu-$ÅtD$${ u[]UǀdS$;uƀ <<0<ÐUƀT]UǀTUT]UƀT]UǀxSǀ|SǀSƀSfǀSfǀSǀSǀT]U $t$|$1щfʃ8:8tȃڃ?11ဃ11f$t$|$]UxS]U|S]Uǀ|S]USÀx un;D <<:;t ;u < <<(<\$$ eD$${ uO<4< < <u#<:<t <u[]U]uÀx w @ $Ƞ\$$\$$<:<t <u<4<ƀ <ƀ <<<\$$r{v{ t\$$Q{u\$$\$$S <<$< <;L <:<t <u\$$;F8uMRtD;<<u<$<\$$5(:;s\$$Ƃ<\$$<(<]u]UWVS u} ~x$xSt\;9wIxSpxS79t)99uxS) [^_]U]u}$ue$uS<;<Et1(E9}<:<u$ȋ]u}]UWVS U9;v;<|StU|SxX;9tU )9u|Sǀ|SЃ [^_]UWVS } |SuA|SǀSfǀSƀSEE|SS}TUuS S$ƀSvƀS_ƀSHESGfSUU<u ƀSSS |S;PSSƀSƀSƀSƀSSpfSVSƀS D$D$ lD$t$d$ǀ ǀؚD$D$>D$D$ lD$t$d$ pt ǂpy ǂp @sEE Eԉ$OǀȚdu]ǀԚD$>D$ D$lD$d$ǀܚǀؚD$>D$ D$lD$d$&p@t ǂp@ aEEEԉ$=ǀȚdu]ǀԚD$>D$ D$lD$d$ǀܚǀؚD$>D$ D$lD$d$E pE؍Eԉ$_[#EE]ԉ$0ǀpduiǀԚE $D$D$>T$T$ lD$D$$ǀؚD$D$>D$D$ lT$D$$E E]ԉ$?E$0,@EE@]ԉ$ǀpdufǀԚE $D$D$>T$T$ lD$D$@$ǀؚD$D$>D$D$ lT$D$@$E E]ԉ$E$[^]U]u}}t ƀ̚uԚt U T$<$СMD$E D$<$ut$D$UD$ D$D$<$D$U DzD$$t$<$КК_~uI ufК0uZtQ ~E؃t*Džp"p$Ě%ǀܚt U T$<$Ћ]u}]UE D$E$UVS]u lD$ED$$<d̚UUǀԚǀؚǀȚUĚǀКǀƀuǀǀ*[^]ÐUE@tǀǀfDŽJfDŽHuߡhǀ]U$t$E49w)؋$t$]UWVSEU BEHE@y]ƃ9uU f~ E@y]S)ƃ9uU fB~ E@y])ƃ9uU fB~ E@y]Sƃ9uU fBU ~ EE 9E1+UHt AHD$UT$ $[^_]Uƀ ƀ ƀƀU ]UEtDt\tǀ`ƀFǀcƀ)ǀfƀ ƀ]UVS]t# 19t D$$ [^]UU ]U}uƀ ƀ]UuD$E$ÐUS]tСЏ[]Uǀǀ]Uǀǀ]Uǀǀ]U]U~$"ǀU~JǀЏǀԏԏ$ǀǀU?~L$,ǀԏԏ$ǀǀU~Gǀzǀԏԏ$$ǀU/~Xǀrǀԏԏ$̏@ЏǀU~;ǀǀԏԏ$ǀU/~;ǀ@ǀԏԏ$ǀU;ȏ|;ǂǀԏԏ$ǀU;ď|;ǂǀԏԏ$ǀU;ȏ|;ǂ9ǀԏԏ$ǀUMQ̏Atbǀ4ǀԏ̏@tǀď@ǀȏ 9ǀďǀȏǀWǀԏǀЏԏ$UE8u USE D$E$T$áT$ T$D$$t$$$D$$u[]UVS&$É$t$D$$$ƅuȋE D$E$[^]US]$$$[]US]$$[]UVSu ^U\ED$$4$$$4$$$$ED$$[^]UU@tǀ,ǀ,ƀ(]UWVS,uE D$4$$]\$ E D$D$4$Ǎ4C tЋ,((f(f9uED$ D$ED$<$,[^_]UEw$lǀǀǀ$ƀ ǀǀǀ$ƀ ǀǀ0$ǀ$ƀ Gǀǀ$@ƀ U0D$E D$E$ÐUEf@]Ufǀ@ǀD]UWVS fMMEEtEEEE!uE1M0Mt f]tE!f9tE}t ee뫋]E [^_]UWVSE EE@fu 7 f@7@D$f1f11ËE E+E 9u[^_]UWVS}E EEf U 1Éf 1É11ӍG$u1f fE E+E 9u[^_]ÐUUtСƀƀƀU$"ǀ؏؏$ǀU%~$%u'Ƃ!ǀ>ǀnte !%$ǀB ǀUO~$%tg !%$ǀB ǀƂ!ǀpU~<%$ƀ$ǀUMQ̏ƀǀIǀǀǀ؏A A A A ƀ ƀ!ƀ%$؏$U~bftWtN~9$ǀǀǀU]u~$@<$ǀ؏؏$5Ȑ)ÉȐ !ƀ"ǀǀIǀǀ]u]U/~nǀ؏؏$̏D$$ ƀ"ƀ$ǀzǀU0;84D$T$ $D$$$ ǀ؏؏$ǀB ǀǀǀU@D$$@ ~@4D$T$0$D$$ǀǀgƀ uƀ!ƀ%$ǀu ǀ> ǀpÐUS$ȃ ~@~ډffǀǀfvffwfwfv[]US]Nƀǀǀ[]UWVS,}$̐Ȑ)9~ j̐D$<$E )E5U쀾])Ӊ+1)ЉE)‰1) uE9\ƁDE4@gfff)9U|EU4)9U~,Ɓ uƁ t;E~#;EEU쉐U T$ ̐T$D$<$ơĐt*'=ƀĐƀĐuP~ƀĐƀ?E D$D$ D$D$$U T$$E D$<$)Ȑ ̐T$ЉD$Ȑ)%$,[^_]US]ȐD$E D$$Ȑ[]US]ƀ̐D$D$$ȐǀfǀǀƀĐ@tǀ ǀ $[]ÐUU ǀǀǀǀǀǀ ǀǀǀƀ$ƀ%ƀ&]UU&]UVS @ۃ ۋ$T$ )މ3)3)ǀ[^]UWVS,ED$ED$ D$ T$E D$E$ E)‰ E)‰$T$ @t ɉ I $%toUD$$M5 E UЉ]M)ˡ&t;.%t &t  y*4=~(-ȍe[^_]UWVSLEUE̋ % ƒU @Eȍt$C@D$\$ D$ |$$ 뀃@9]u΋UUЋMM+E EܡEEU䍄Ƌ}E@EM^G؍FW)MFW‰)ƒ;uuM䋁tE tftQveEMMfMUfB^MUfEMfB=EMMfMUfBMUfEMfBE}~mEEEE9EUD$B@D$T$ D$ |$$ UU+E E؋ MƋ}E@EM^G؍FW)MFW‰)ƒ9uuMtH tvtSt&eEMMfMUfB^MUfEMfB=EMMfMUfBMUfEMfBEEE9EE+EL[^_]ÐUEt0rv[ƀ)ƀ(ƀ*hƀ)ƀ(ǀ,ƀ*3ƀ)ƀ(ǀ,ƀ*]UWVS}4?T$ T$D$4$D$4$ +00‰0 490v00;4vƂT$D$<$T$ $D$T$<$(t@D$@D$<D$,D$ D$D$ <$@T$@D$$`[^_]US$]*t<@D$$)tXD$@D$<D$D$ D$D$ $áD$$D$$Rh؃$[]UE@tǀ8ǀ8` 8Љ4ƀ)ƀ(ƀ*ǀ0@<@D$D$$@D$D$$@D$D$$D$D$$D$D$$ÐUWVS,EU E܉EEEt$$E^\$$lj\$t$$ÍFD$t$$EMɋU?9~%:9~U[9~MI9}EE}uy+E EE9uEE9E~ƀ }tƀU쉐,[^_]ÐUƀ!ƀ ƀ"ǀLǀHfǀD@fǀF]UED$E D$E$ǀH t!"t L L!t!"t H HU(]u}} $D$ LHD$DT$E$DF) ~f~ AfD+AfDyf~ FfF FfF|$ $D$|$E$]u}]ÐUUP@tƀU ƀUǀX]U]U(]uUutY]\$ ED$E D$$X…t0t$ \$UD$$Ét$$؋]u]UEtrv@ǀXS8$ƀTǀX $P@t ǀX ǀXUWVS,u ]E0U؉E܋}MMNfyٸfyf9}fEfT)ȃf fT9ut E뉉\$ D$ED$E$f#fc9]uE,[^_]UWVS,u ]E0U؉E܋}MMNff9fɘ9~fMfT)ȃffT9ut E닉\$ D$ED$E$f#fc9]uE,[^_]UWVSE؅tËU EËMEЉ!ӋEE<`u FwMĀuTE89t-fu9vƐE9s9w\E9rT}`uM5D$ D$D$$`t D$ D$D$$g t D$ D$D$$gpD$ D$pD$$lse vXG;DžddD$ t\$D$U$+ED$ D$L$$ru38t%D$ D$8D$$wD$ D$D$$s t" ` ~ M+4t u.D$ D$D$$~ D$ D$4D$$V0$D$QT$$4$D$BT$$<==wm=|=w& @^=>==t&==w,=  =@=uI==fw=u$&= = tj$@uxq$@u\UNt@$-t$ Q\$ Bt$T$$($D$\$$,$D$t$$8$D$ \$t$$8$D$ D$D$$T=tB^$pD$ D$pD$$8^kD$ D$kD$$\kD$ D$k\$$ XZ)Ѓ kHljjD$ lD$\$$kppvdd|$ pt$\$$lptdR``D$ |$t$$SpPdQ``D$ |$t$$xV$pdk\$ |$t$$Mbi)dp`D$ |$t$$LD$ D$D$$!!t ]u}]UD$ D$\D$$YUWVS,D$ D$T$$6|$É$ !ЉEu#uu Et& uE D$ ]\$D$$=uD$ D$D$$ED$ |$\$$DfED$ D$ED$$Dv)D$ D$D$$?uD$ D$D$$,[^_]U(D$ E D$E$M]7oD$ T$vD$$D$ T$xD$$}]D$ D$D$$EE-D$ D$ED$$Et$D$ D$D$$E=E됃D$ D$D$$ED$ E-D$ED$$Eu$D$ D$D$$E=ZtE닸U(f-ff=u5ED$ D$ED$$fukf=t&v0D$ D$D$$D$ D$D$$YuEf=vtEtED$ D$ED$$YUWVS|}] t$$$(@tX$#uƀ$$<$ut$<E<8Lƀ%<;uƀ%D$ D$"D$$iƀ%E<;tY.EjEE؉$4[]U?ufuu.0]U]UE w/tǀ]U]u}M] =tiC"At^tSC "A "QUtut+CS"QUS"QU"AEtEuuDDèt8ǂP EtǀLǀLǂPEuutǀPEtǀLk tǀLVEtǀL=tǀL (tǀL tǀLǂDȋ]u}]UǀD]UU:OB 6$ǀjǀLǀPHHǀjǀLǀPRXvRYfǀjDtǀLǀPXt"YtǀL ǀP]UU:OB 6$HHǀ2ǀLǀPRXRYqǀ2DtǀLǀPzuXt'YtǀL ǀP]UE"wƀǀ]UWVS]u9t9uM #E M[^_]UM8t8u]USU"!$x ,t(tuyBwnǁ(,bƀǀEǀ04(tt ,u$ 0[]US$2t$3[uЃu#t Љƒ[]UM:t8uE ]USu$)t0؃[]U$'tt uU=@=@ = = @@wE}wmQ  =3=w== ==n==wU==w!=@=t&"G==.=s=w= _=@=?=@/=$= @= @=@=@wQ=@=@w=@=@B= @=@@"n!=@=@w=@=@C"=@_=@**=@?=@wQ'=@+=@w%=@@=@(=@=@t&uf-=@@=@@t&w+=@= @u2/=A0=B.=@xt&le f\UfLEf<5f, %#f&)f , ]UWVS¡u&t u fUE)yu9 ƂƋE 9E t&U áA9uߋuU t%E%9{%Ujft[^_]Uu$u-u$u+ƒy ]U$<]U+y]Uu+y]U$utu"uu+y ]U]U]UU<u]U8"EEKE$EE܉$U8EIEE܉$UWVS u} Efv~*L0t$ip +ƒyU9~uU9s;) ;%9uΡt ƀE [^_]U]U]UE w2/u t ǀǀ]US]$PtPRt(Eug{uaƀ$ǀ2D{u>ƀ$ǀ2!{uƀ$ǀ2[]UE]UWVS]u };sr;t49tv ˍ˅u<tt&!Bu[^_]USU] M;Zvt!9Z s Bu[]UVS@MEj<9t @9uE<E܋@E09t 49u3E0$Eܡ4$E(9t ,9u3E($Eܡ,$E:~9t |9u E~E|ED9t F9u EDEFER9uERES9uESEP9uEPErQ9uE QER\9u2E \EXZ)Ѓ EH9uE HE^9uE ^E`9t d9u;f fǂE `U܋dEl9t p9uElE܋pEPt9t v9u EtEvE89$S$P$Q$`$l$v$E8E܍Eԉ$E8Eax9uExEDV9u 4$EVE9uEE܍Eԉ$@[^]UWVS E$2$3$4  át$$2t%=u E$%@t=uMM$%<uAEF<w$v_߿u߿h߿ [@TMF?8f/( f@f$y7u <$==f߅t,t%t!Et$}tG lj}$uTuN t>y2 t/"t@vO$t @t؃Á %à t@tu % LtЃteu teuut<uuEE UEU [^_]$;U88tElEE܉$UVS?ufu5$< Éu.0t 0u0(uu[^]UXE%t$7EEE$USTEEE(E,EHEEE$)ue]$t0t!EPEE$T[]UXEEE E$)eσe$0t1te(E,EċHEEEE$UXEEEEEE$UXEEEEEE$UXEE$UXEE$UXE(EE$UXE(EE$UXUƀ<ǀ4ǀ8E<EE$UXƀ$ ǀ<t$EE$ɐUXLƀ<ǀ4ǀ8E;EE$UH]uuEu] ]܍Eԉ$\$4$]u]U(]uuu3u%ǀLIǀPƀÅ9~9tAǂ@ǂDjHD$$jtKLt=t E ED$ D$ED$$򈐶]u]U]u}M} $ )ЉEyEu9~΍>9t+)9B9uޡU)9}$]u}]UVS Eut$D$$|;Eu[Et$\$$t$\$$|;E [^]UWVS Ɖ׋9urt&7u3$?v [^_]UVS@ǀD$T$$|ǀ||t$\$$|t$\$$tELEԉ$Ѓ@[^]USUt:)ӡ ?uȉȃ[]UVS])؉á ?uܡ5$< Éu30Ѓ[^]UH]u}u<$:/tAEE]Љ$E}ԉ$ǀtǀp@ǀxǀ|ƀƀƀƀƀƀEd Eԍ]Љ$EE$$ $<$]u}]UD$ D$D$$ƀ$ƀƀ ƀƀǀ4XtƀXǀLǀ8ƀƀƀǀ<ǀ@ǀDǀHǀL\D$$PD$$ƀ ƀƀƀƀDǀLǀPƀZǀTƀXƀYǀƀƀ1ƀ<ǀ4ǀ8ǀ@ƀ2USTƀ$ B<w!r>XB<H?$5fu$#<u" ^uxE$[ )$E]$EAEXEE$E EHEUE]$EUEEE$eEEE$T[]E$\ )$E]$EAEE EL$EEaE@EDE$[ )$EE$EEE$[ )$E]$EEE$<EEEEE؋E܉$UWVS áǀDǀHǀLƀZǀP$3$1\$D$$U  tKCtKtK0tKtKtK KtKtK@t$tKtK CRCSCTtCR  t2SRʀ ˆSRtЃ CSKR [^_]Uƀ$[:ǀTEEEƀXƀY$2tuM[EEIEEE$US$]ƀwuu$XtǀtD$2tut&u~ǀmED$ED$E$]tǀ29t,$@tE tǀ2$[]USU] \u\$$ \$$\$$Åtdd$؃[]USMU \uT$ $T$ $Åt``$؃[]UWVS<}~!$ip EЋ+Ãy)9 A$;]}ƀ]}hE D$U$EE E̡]9] AEE܋U < $  fEȃEԀu2u9E9EUӉUUȈU}E9uN:]fvratEED$$]:]%4}EEED$$E:EEԃawm  w}u Ƃ9EuƂ uƀ 9EuƄ y]Ԉ Y:uOuFu=Xu4Ɓ +Ɓ ƀƀƀǀEt9Lt+:uƀm,:u ƀFƁEE+E ;Etp1]EaEAED$$ED$$UȈ:]ƀ%E<[^_]UX]u}]E]ÉEȍEĉ$$ƀu3$uOuA$3u.$ tXt $$V!$„|tkXY$_teLt)D$ D$D$$'D$ D$D$$$_ ttLt.D$ D$D$$@D$ D$D$$f$_$8@t:(t)D$ D$D$$($D$]\$$D$ D$\$$J$D$]\$$D$ D$\$$$_KL0%=u)D$ D$D$$ =u)D$ D$D$$t&D$ D$D$$|=u&D$ D$D$$O tJD$ D$D$$!$D$ D$D$$'D$ D$D$$-$_t7L0t)D$ D$D$$0cD$ D$D$$-:$_t?D$ D$('D$$D$ D$D$$t t&t$D$ D$D$$-Í@9} D$ D$Í@D$$t$D$ D$D$$7]u}]USEEE؉$ƀ$ƀƀ$ip ǀ$D$$m(t,tuE_E$$t &Ĕ[]vUS]Pt&P"Qt&KCfuǀ~t ƀǀ{ue{t0L88$L 8 8${u?Cfxx$ƀǀ[]UHtvtu VPul$$ tD$$m$@tD$$kENE܉$XuƀX\tWt%D$ D$hD$$9ǀ\ǀdǀhVuƀV.V$TuƀVV$s<u$@uƀV^V$F8t$PtƀV?V$ƀV=V$t"D$(D$$pU uu$<[^_]UVStСǀ@t0EЋDEԋHE؍EЉ$ǀ@Lt'EЋPEԍEЉ$ǀLEY  tƋÍAw7t3i9p} Ƃv1*ۍvt#vwEEE$v=pt ƀv  f yBL0pBp2vǀpxtcfv,vXft,vMǀpfǀvfǀtǀlDž8/8$xuSfv+v ft+w=llu3ǀlDž8.8$ ǂlfǀvfǀt5ǁpǀlfǀvfǀtt9t $ƀƀ ƀƀǀ4ƀ uMƀƀƀƀ uf9~WuNƂ$dt7ddu ƀǀ4@~_@@9ǀ@ƀEEE$t4ǂhdt ǀ.ht hǀotou ƀs$u $REÃt'9u uED$$Cw _9Ƅƀƀƀ9E9t9%;^9uNt9tD$ ED$D$$@ƁxˆBƁƀƀ{AuƁU[NTUЃtuat'ƁAt Ɓpu?at؉Ӊ…t  ƀfǀfǀƀƀ k/u!Ɓƀƀ E>u@$(x0ƀƀƀ ƀ  ƀs;E$ƀD$$t ƀ$D$$$$$$ fƀƀD$$D$$t"  [^]USM9ƀB<vtuuA$A=uBƃTu tƀX$ǀq=ujƃT Xu!tIƂXXt1<uu t $ ǀ[]U]u}uDt=vF$uK$9t'< uu uNu!N$uF4$>R$D~t&t ƀǀtSƀBFnu&F$u%|V|u%E8EE$pF$<$0t$0<_ƀ1N~u ƀUFE؅u$?E؅tEDFEԍEЉ$$(~"F$F \\$mF^^$^4ƀ^^$FHH$F$F F VwVd~Z$NjF$f)fX,VfZF fDD$F fFF$Ff~~$Ff||$pLt%LOǂLV<<$V@@$LRR$軹$LSS$im$\PP$QQ$t $PP$LV_tƀVAV$L茸F(($0uF00$L7F,,$4uF44$LL$t 蟷VxǀpǀlfǀvfǀtfLVxǀpǀlfǀvfǀt~u ƀD$4$@]u}]USƀEE$蚶$&kduNnƀ$L0tEE$@$y/ǀEEEE$Ą[]UE8BxXuǀǀƀǀ4u*t v ǀ $ƀ$ƀ ƀƀ$US]Et(E"fFf{&Ku uiǀ{u;SD$C D$%$ǀ&(,L88$C$L88$L88$^C$PSfz?Cfxx$ƀǀ[]USE"|N#~$ty%u?ƀtǀǀzLufǂ$tS$Eǀ04(tt ,u$ 0[]UVSp$ $$_($D$ut$$$_tH,$D$]\$$D$ \$t$$F_D$ D$ED$$Y:D$ D$(6D$$ƀ$Skd(ǀ\^\u$ƀ'$ƀǀ4$kddƀ$D$$mIƀ3Ptbt t&英ƀ$ (,,t(tu-$ƀ$ ǀ(,$<t<<&uPEE$E$tMEEE$ƀ$ ǀ( ;ƀ$ ǀ( $0t<ulNtcƀ$ (,uO$$ƒBvu1(,8ƀp[^]US]H~$ADAD##"K% %@YPvPf#EGfDaom=YRt&:Cyu~S8842D$ D$8D$$hƀ2$wu{ zt&u}ƀ<ǀ8ǀ42RD$ D$D$$uƀ2$ \=u2uƁ$ $ƀ`{>`${Chu{ kC$8hPSpp$S fvv$ Sll$S ftt$ƀV_V$_ƀ${}ǀ i{_ƀVdV${2ƀVdV${ Cf$phSpp$S fvv$Sll$S ftt$aƀV_V$ƀV\V${ƀV_V$$uHƀVV$ƀǀo$n$9@u&D$$},@&;uǀǀ${?ƀV4V$qǀ0(tt ,uw$ 0`VuƀV<V$2tƀ2ƀƀǀ[]UM9-uAw/ǀLu ǂ $USƀ$ƀǀ4ƀƀƀ ƀƀƀƀǀ\ƀ`ǀǀfǀƀƀƀƀƀ$$$$ƀƀƀ0$ f$ǀ$ǀ(fǀfǀƀƀƀXƀoƀsƀlǀǀǀLǀPƀXƀYǀƀ#ƀƀǀ<ǀ@ǀDǀHǀLǀhƀ4%ǀhƀƀ ƀƀD$$$ tD$$mD$$m$@tD$$kD$$kD$$}D$$jfǀvfǀtǀpǀlƀxƀyǀƀpfǀƀfǀdfǀƀǀfǀfǀfǀƀƀƀƀƀƀƀƀƀǀƀƀƀƀƀƀ1ƀ<ǀ4ǀ8ƀ2ǀ@ǀ@ǀL[]UH4$D$($^4BƀvƀƀxƀD$$ǀkƀ u$$@:4t $(D$D$$p@4$ƀE[4EE܉$U]u]$$ = $s9]GC{[ (L $. ƀƀVV$ Citl v%S ‘ {G5$t]$$ƀǀ4$Xu=ƀƀV V$$lƀƀV V$@ƀƀV V$$Sb DžC $(( $$  $ƀǀ4Dž$Dž$Dž$wS S ЉE\E؍Eԉ$"C=v-$C$CC ewXSCS{u S<譠{Uf}C C SCA'9uACS SS?륋K S{C$S\vS`^SdFSh.SlCt&t9StSxS|{tƀƀftD$D$$0/kƀ uǀ0D$tD$$ C04;C}$cpC$]tCB$$S4E[CEE$SC$C$S8S<Cvipg$9N</$"< <$9$< <{$j8]$@ƀEEE$C8$$@ƀDžhlh$ƀ{u10ƀ@"< $9{t@D$ D$D$$9ƀV+V$$<t<u Ƃ?XuD$$ <u ƂƂv"ǀ ]u]US$ǀUǀƀƀƀƀƀƀƀDŽ uEUT$\$$ED$D$ 1%$$ǀ ǀ \ǀ`dǀhhltǀx|ǀǀǀ8ǀ<ƀ4fǀfǀƀƀƀƀƀǀ$[]ÐUUttt]UU0t u]UEx%ȸ9t 9u @y]U]ÐU$t$É)Ⱦ9  9‹$t$]UMu;yuƀ?ƀǀ<P$uQ8]US]$;uS8[]USTË8t1E0EE$tǀ8T[]UWVS|$u$@u?$0t/t&Du$ƀDt ǂ<P < v < ǂ<<tu(tu&t <H;8 HH;8rnǂLǀDǀhD$ D$D$$ƀD ǂHu <t@;0s0 @%@t =wǀ@Hxt ƀD$$}@-DhDPhhu ǀhDD$$D$8;(w";$s1<w DvB<v $AfE$AƒUEE uh+yE\[u$= P+u~\Uҍ4E!ËVPt+V\tEE9EtEU9Uu"EEtUUuHEE$}tuD;0w]u,9wE$@u!D=]v=wƂǀ8ǀ@@ƀD$$}HdLhu ǀhhL\DtLD$$ǀHL$ƀHu49w{$E$xD$ D$|$$t$É$}tE9ƀƀ{n<aTƀƀ D$($ƀT$$kd$uu u t ǃ($:(EEEEE$$[¡ Ef)‰И$EE)EE$ƀ$t&u$|[^_]ÐUEBރvusuǀ-k]UE8Cuxu ƀt]U;t%]UWVS-+0EtEtEtE tE@t}yЋ]u}]U8]u}}] $WƃD$$tO$9ED$ D$ED$$ D$$t6D$ D$D$$ j€<=uYBD$ \$<$u5w7ED$ D$D$$9 ]u}]UVS u] D$$t^$Eu E!ED$ D$ED$$ D$$t.D$ D$D$$ x€<=ugBD$ \$4$Eu Eu Ew+D$ D$ED$$ [^]UVS u] 8?uGB$FED$ D$ED$$ D$$t.D$ D$D$$ \€<=uKBD$ \$4$w-ED$ D$D$$F [^]UVS u] 8?uGB$FED$ D$ED$$ D$$t.D$ D$D$$ \€<=uKBD$ \$4$w-ED$ D$D$$F [^]UVS u] 8?uFB$FED$ D$ED$$ D$$t.D$ D$D$$( \€<=uKBD$ \$4$w-ED$ D$D$$F [^]UVS u] 8?uGB$ED$ D$ED$$6 D$$t.D$ D$D$$C Y€<=uHBD$ \$4$w*ED$ D$D$$ [^]UVS u] 8?uGB$ED$ D$ED$$S D$$t.D$ D$D$$` Y€<=uHBD$ \$4$w*ED$ D$D$$ [^]UVS u] 8?uDB$FED$ D$ED$$p D$$t.D$ D$D$$} \€<=uKBD$ \$4$w-ED$ D$D$$F [^]UVS u] 8?B$'t+ft>t)t&u0'Et& E&EED$ ED$D$$ uD$$t1D$ D$D$$ 0€<=BD$ \$4$E€<,u"BD$ \$4$;EEtHrti=D$ D$D$$'D$ D$D$$'[D$ D$D$$'0D$ D$D$$' [^]UWVS,u] $)8?Bw$t<ЃEEEE%=@t0=@w tv@=t)=fu0'Et& E&EEED$ UED$T$$ D$ ED$ED$$ 9D$$D$ D$D$$ D$ D$D$$ E]D$ D$\$$ EE=vD$ D$D$$ o€<=ZBEEEEED$D$ D$ \$4$E }MU trt&tu+ m ϒǁ $oǃw E%ED$ D$|$$)?E E ,[^_]UWVSL} ÁEtEtMEE؃0H u܉ف UljEE؃ƉE؃ЉUE8?urBUЍE؉D$ EԉD$T$$ ED$ ED$E܉D$$ ED$ ED$ED$$ D$$D$ D$D$$ D$ D$D$$ EEUЃ=w~!uԻD$ D$t$$ 9uD$ D$D$$. uԻD$ D$t$$ 9ЍUЋ@$9EEЉD$ ED$D$$5 uԻD$ D$t$$ 9uD$ D$EЉD$$K uԻD$ D$t$$ 9uD$ D$D$$Q ‹M<=|BEЉD$D$ D$ |$ $$W@UЃ4}*}M܁]}}u0}0 99vttfu  EйtuEE EкtuE0% UE% ¡ jcD$ D$D$$. X\й2D$ D$EЉD$$K L[^_]UVS0u] 8?B =X ; u;t=Xr @EED$ UED$T$$U _D$$D$ D$D$$$f (=Xs0D$ D$CD$$ XuD$ D$D$$Q €<=BEEED$D$ D$ \$4$}uW =XsKE 9$t)9Au) # XrǸ En0[^]UVS0u] 8?uNB%EED$ UED$T$$s D$$t1D$ D$D$$ €<=uoBEEED$D$ D$ \$4$Ew.}u(E 0[^]UVS0u] 8?B$&Etu1EEE%EEEEEEUT$ UT$D$$ D$$t1D$ D$D$$ €<=BEEEED$D$ D$ \$4$EwX}wR}wIvtu EED$ D$ED$$&0[^]UVS0u] 8?B$(ttuEt&EEE$FE$?EUED$ ED$T$$ D$$t.EUT$ UT$D$$ m€<=XBEEEED$D$ D$ \$4$E}tArt\t&rD$ D$D$$(pD$ D$D$$(JD$ D$D$$($D$ D$D$$(D$ D$ED$$FD$ D$ED$$?0[^]UVS0u] 8?YB$$<t!<r <vt&<u2EE.EEEEEE$tt.6tEExEEh$0t E&.E}vuEEEEEUT$ UT$D$$ D$$D$ D$D$$ D$ D$D$$ D$ D$D$$ D$ D$D$$ D$ D$D$$! D$ D$D$$( D$ D$D$$+ D$ D$D$$ D$ D$D$$. D$ D$D$$ D$ D$D$$5 D$ D$D$$8 D$ D$D$$; D$ D$D$$Q €<=BEEEED$D$ D$ \$4$EtwEvEE}!E$[J9($0M}E$ D$ D$‰D$$D$ D$ÉD$$$D$ D$‰D$$00[^]UWVS,$F`E5<Ӌdt( ,h $E,$EED$ D$ED$$@ D$ ED$ED$$L D$ ED$ED$$[ lE ,[^_]U($Ft9$ED$ D$ED$$p UWVS,ED$ED$E$u}E?Id!9u$ht t)EuI<`uȃ,[^_]UWVS,} ]EE8?BED$ED$E$D$ D$D$$g UR`tz`p tnÿS#E9uQu$D$ D$D$$n D$ D$t$$p s uD$ D$D$$s D$$D$ D$D$$v UR`tdlR4`u&ND$ D$D$$n D$ D$\$$p ^ uD$ D$D$$Q ;‹M<=#BURdU`E܅MIE؋]؁`uE܉D$E$t vd E‹M<,uC 뷍BU<;tuE t&D$ D$D$$2$D$ D$D$$2D$ D$ED$$3,[^_]UVS0u] D$~ $9ˆ8?BED$ED$E$E E=w9t?,D$ UED$T$$ ;uBED$ UED$T$$ cD$ D$D$$ 5D$$t1D$ D$D$$ €<=BD$ \$4$EED$ D$D$$3}uEUUED$D$$U0D$ D$D$$30[^]UWVS<}u E8?B$Ec@d t$RE؉D$E܉D$Eԉ$E0tU܃;øE t =v9v!‰UE؉D$EԉD$E܉$E0tUԸúE t‰9sЉE^Ãu$yD$ ED$[`D$$ D$ ED$ED$$ D$ D$D$$s D$$D$ D$D$$ =`tl uv`x#D$ D$CD$$p t? ut&D$ D$D$$n E,ED$ ut$]\$$ D$ t$\$$ €<=€<,tX`pED$$tˆ€<,u%El 'EBEEEED$D$ D$ t$<$}UB=*E=9vUЍR4duMD$ D$D$$D$ @D$D$$}uJD$ @D$D$@$D$ D$D$$HD$ D$D$$D$ @D$D$$UЍRhE t E@t&D$ D$D$$%$D$ D$D$$%t0tJD$ D$D$$2D$ D$D$$HD$ D$D$$2D$ D$D$$}t+UЍR`x tM r JB uM}uE,}uEU@w'}u uED$T$$ t]\$ED$$ED$ED$$\$ED$$ t,D$ D$D$$2$D$ D$D$$2D$ D$D$$3D$ D$ED$$UUCEt&0E 'E@Et&EEƀEEE$p[^]UVSpu] 8?uAB4ED$ D$ED$$$ D$$r$cD$ D$D$$1 D$D$$CEGƄBE+;tl)‰Uu*D$ D$ED$$: #D$ D$ED$$> E9t4냡4ED$ D$ED$$C D$ D$ED$$Q `€<=u=BD$\$4$=wETEEE$p[^]ÐUWVS EӉMEE9sDM}8B< v B<w$BɅu f ;Mrĉ+E [^_]UE"wƀǀ]UuF$t<$u/ƀƀV,V$U$t<$u/ƀƀV,V$UU"#~@t& ƀǀzRuƀǀt u w3u.v$D$ D$D$$ u ǀ1ǀƀ$"UU"#~@ ƀǀBttv$D$ D$D$$ ƀ$<w[$ƀAv$D$ D$D$$ ǀUXu-Xt<~$fnXuYƀ$ƀEE E4EEEE$ǀR $Uu<t<vu<v %$ƀƀ$"UuH$t>$u1ƀƀV,V$qtauTu w4fu-v$D$ D$D$$ U]u$<u&Ƃƀƀ ƀƂ tM|9x~!t ǁtƀcǁtƀK|)9x}!u ǁtƀǁtƀUS]t (g;t&Lft7t&Ky$Ƃ ƀǀuKuJbu@ru6$ u,iu"dueuc:u u)ǀƀ C;L  6SЅt]ǀy ǀǀǀЅǀ ǀC/^CUǀƀ J~.ǀƀ #Cc=t =u e[]US]$;UuRSu o>t0u+t ǀuƀ []U]uu4$Uu?t1~u+t ǀu(ƀ ]u]UWVS,u} uZ~V;Dփ<;uD~E։D$$9uDž~E։D$$,[^_]U]u]M tVtv4gfff)ʉ)Љ5ǀ)Xu Ru É$DuƀD$]u]US$tt Xu Xvq}uv] 2Q)‰UD$ ED$L$${Xu .$[]UVS gfff)‰U)‰UXD$ ED$ED$$.ǀǀ [^]Uul$ƀ$$ǀƀƀt $tU]uu4$t2BuO~vuFǀ t)"ǀ t]u]UXǀǀǀǀǀƀE5EEEEEEEE$UXUBwJuFǀtE)EUE$ȉUXE)EE E$=  E)EEE$$UXE4EE$tUǀ|ǀǀ<ǀǀ2ǀ ǀǀǀǀǀ@ƀǀǀǀƀǀǀǀ2ǀǀǀ ǀ$ǀ(ǀ,Xu$UUt ǀ2Vufƀu ǀ$kdUƀƀƀ$&<w ǀǀǀƀ$$$USCÁuvƀ!t!wuldvt:uu]&Gt:=3(~~ uƀ;:t,t kdu tu~6uqƂ ~2uǀ[]Utu)tuUST];a$ǀ$ƀƀ{t $c$El,E]$EmE E$$:$$ƀXT[]U~ ~Au)qt (u~2uǀ$~E$$u.$$ƀXwUS]tc tvtMv?ǀƀ$ƀXctUƀ$u$ $ƀ$$[]UXX$$u t $ƀƀ=tf=tJtet1o=tW=| =ft'=uPEEJEE:EE*E EEE EEE5EEEEEE$tqƀƀ$%kdǀƀ ƀƀ$UXX$$u t $ƀ$ƀ=tk=tOtjt6t&p=tY=f| =t)=fuPEEJEE:EE*E EEE EEE5EEEEEE$t}ƀƀ$'kdǀƀƀ ƀƀ$UXX$$u t $ƀƀ$=tg=tKtft2p=ftW=| =ft'=uPEEJEE:EE*E EEE EEE5EEEEEE$tqƀ$&kdǀƀƀ ƀƀ$ƀ UWVS@@{  @ @E@@,@})à @ @}[tDž<ƅCQDž<ƅC+}Dž<ƅC[@]\ơ@]@<@] Ãn<aX!ƃ<!$0t.[t&#$0tut&]u]ÐU]U8EnEEE܉$U]US]M <=t9=w =u=&t0= t)f.%@5 US:u?uбfu[]UD$ E D$E$UD$ E D$E$US$D$ E D$E$Í ewhED$ D$ED$$D$ ED$ED$$ 9u{EEED$ D$ED$$E;EmD$ D$D$$?m$[]UST=2]9uETBE$ :uָT[]U0t)Ƃ0D$E D$E$sU]uu] 2,uJD$ \$4$u2,uD$\$4$]u]UD$ E D$E$t wV+D$ D$D$$_)D$ D$D$$_UD$ E D$E$%D$ D$D$$5UD$ E D$E$=%D$ D$D$$USD$ E D$E$ø$'tkt3ېt&D$ D$D$$'|uxD$ D$D$$'RtND$ D$D$$'(t$D$ D$D$$'ƀ[]UD$ E D$E$tru<¡ƀD$ D$T$$'UVS u] D$$ P?u?$(ED$ D$ED$$=u{€<?fu0BD$ D$D$$ ED$ \$4$'D$ D$D$$( [^]ÐU$t$M9)y A$ ytQQlQQzQbQJQ2QAA"ǀQfQ fQfQff̍fʍfȍfƍ>QfQ fQfQfQfQ fQfQfQfQ fQfQflQfQ fQfQf&Q44?QQ QQQQ Q Q$QQ Q Q$Q(Q,Q 0Q$4 Q8Q <Q@QDQHQLQ PQ$TQXQ \Q`QdQhQlQ pQ$tQ$t$]UWVS]4)D$E D$ D$D$ $T$D$$D$D$)؉$   EQЉ9tUu΋dD$hD$D$D$ ED$ D$$dD$hD$D$D$ ut$ D$$Ӌ t*E!ډUԍUЉ$:u@:u8:u0:t(EUԍUЉ$ D$ED$$tH808vE<u$t/%%EEEЉ$D$ED$$ EuN;|62~+ƀEEЉ$ ǂ<8@<D@UD 8<u@DE!؉!! ] !>E% ݀E<݄ 3E tqȋUUUEȋ؍uuH܍u?Uu2u=u4u+u"uGE9Er0ȉEu;wE9ErEu;܍vuEEUȉEU9r!;wU;r;E9uw(;wu9urU;܍E9Er+ȋU;wU;r;}t}u6Ƅtu*}fE E |}tS}t-}t'|v|u Ƅ|dƄ|U G|;|.%E!Ƅ| E!tttDŽuutA t4ȋ܍9s9E! t4ȋ9s9rHE!;܍t,ut;w E t`<݀( u94t'4E4UԍUЉ$;t7t'4E4UԍUЉ$T$ D$ED$$.t\PLTPXTD$UT$$XVD$ut$$҉LLPLTLXL;Pu`;TuX;XuP;HtHHEHUԍUЉ$؍Č[^_]US] D$D$$Ut ǀ UUƀD$D$$ǀ $D$D$$ǀ48D$D$$ǀHLD$D$$pD$D$$ ǀlD$$ ؍D$$ D$D$$D$D$$ǀfǀfǀfǀfǀfǀfǀfǀ|fǀfǀOfǀmfǀfǀčfǀ^fǀ^fǀfǀfǀƍfǀȍ؍D$$ǀXǀ` ǀ,ǀ0ǀǀ 'ǀǀ'ǀdǀǀ dǀ$ǀ(dǀ,ǀ0dǀ4ǀ8dǀ<ǀ@dǀDǀHdǀLǀPdǀTǀXǀ\ǀ`ǀdǀhǀlǀpǀtǀ2ǀǀ2ǀǀ2ǀǀ2ǀǀhǀdD$D$$tD$D$$|D$D$$ǀǀǀǀǀ\ǀ`ǀ%@ǀǀƀǀǀ,ǀ0ǀ8ƀ<$[]ÐUUU UUU U$U (]U؎D$D$$Tǀǀǀdǀǀ ǀ$ǀ( UWVS,؎P8 ' uP9}e H6 $T)9|9~-9 P9L}L  jHtV;M| E ;| ;Hu^;Hwt#Y(Q,AA AfAAfA1,^(G0B,A AAfAA fA9[4LT=u9~4vDufAiRiD=v`\T(9`r)`)9\s\`vMb Ӂ\@ ցDž(tIǍA@)‰ITA@D)‰%9}9X9P)؍v9}9=9}))(l(A\lu$I)‰ Dž$DžDžDž$l+ u$Ӌ+)‹$ʋ+$)ЉʉƉ $I)‹\+`%`@DԃT9@@X9";~qMԋS )929%\ԋT)929;uGEUE]ԍMDD ;u䋕~E$;8EEE]ED$D$$$4P Agfff)‹E 9u<DžHDžLDž DžDžXo)މ4@DLDŽDžD@DƅGƅ4ƅ/DCG,[^_]ÐUWVSUMMb )Ƌ] )ЍX9E 9}[^_]U]u}] uEdljT ( Q9}9}| 9U]u}]UWVS8}] t@)‰U )‰UȋUЃ0 w E7BwUU E}*t}#4E܁G\GXEGdG`EGpGlEG|GxEEE܃EU U̍@u 9M}9} PUЉʉM9UЅt=E9E|u ;Eu;Eu 9E|tUt&}UE䋇E苇E싇EEUM M̍B‹u;]~ 9~zى]ă9|E9E|u#;Eu;Et&u 9E|t U}tY}t}t&tEEȋEE9E}6E;E~U}M9UtmEM EMWPM̸\EECDEЃ8[^_]UWVSM<29Ë 9} ǁ)‰M2átMá tMxá@tMpáyM^ËE )؉UEEftpMNjft1M9E}/9}}*9M}% E9}} U)Ћ ‰;} !E<M ,HË ,)Љ,,,$Ɖ$)0)ȉ049,}90} E@ E࿉ɀtht\0ǀ`1`0\v`;r ǂ\\;rȃ[^_]UWVS M2 átMá tMxá@tMpáyMËE )EE‹p)‰p9M}pE;l}Eu E$ ‹plt)‰t9M}t;l|M Ex)‰x9M}x;l|MyFU)‰9M}^;l|JMAE )‰9M};l|MpU|)‰|9M}|;l|M@E)‰9M};l|MUJ|)‰9M};l|MUBPzLNjƋ 7)‰9M}-9~$9~;l|MuuUNjƋ 7)‰9M}39~*9~! l9|ME40)‰9M};l|ME [^_]UiE@Mb)¡@U,tiEk' DǀTiU diEk' HǀXiUhiE k' Lǀ\iUliE(k' Pǀ`iU$p]U(ED$$D$ D$D$D$ED$ED$ ED$E D$E$UWVSE D$D$E$pD~r|$ dD$TD$E$T|$|$ D$ DD$E$E D$ D$|$E$r@~f+E@@OǀDǀHǀLǀPEEЉ$tĬ[^_]ÐU8 \t $EEE܉$XUS]w$ $XMLfCCCC CL$X[]U8EBEUE܉$XUED$D$D$ D$D$$dUUB< wH7B<wH(B<wH*t#uEE D$D$ D$ D$ @D$$dU#uED$ D$D$ D$D$$ǀL# 'uǀLUuu uCD$ D$D$ D$D$$dǀLv Uu tN=tED$ D$D$ D$D$$dǀLv 'uǀLUuMD$ D$D$ D$D$$ǀLv UuGD$ D$D$ D$D$($ǀLv 4D$ D$D$ D$D$$u=u4D$ D$D$ D$D$$UuCD$ D$D$ D$D$$dǀLv UuED$ D$D$ D$D$($ǀLv UHƀƀtVD$ 0D$ D$ ,D$ @D$$$ǀLĊ D0t$ t*u3ɍvu ǂH HAH )ȉHEBEHE䋂E苂EE܉$XD$ D$D$ D$D$H $Uu tED$ D$D$ D$D$$dǀLv ED$ D$D$ D$D$<$ǀL Uu>UtZtED$ D$D$ D$D$$ǀL# WPD$ D$D$ D$D$8+($ǀLĊ ƀUVS B< wƒ0t#@vDwEuƒ7t(`v#dt&wEuƒWt*ufkt#t&uct&Kw#$4u EƃD$ D$D$ D$D$4$ǀL ƃD$ D$D$ D$D$$ǀL xDbD@|ID*tf w fƀDtƃ#uHD$ D$D$ D$D$$ǀL# D$ D$D$ D$D$<$ǀL ?ǀLF  [^]U te'uFǀLUuqUE8u,xtƀƀ $UWVS}]M u$ULXU<U@PUDTUH\t ,ǀ,t 0ǀ0}tUǀ2} tU ǀF}tU ǀ ~ $$yǀ$ǀ$d}tU(ǀ(d}(tU(4ǀ4},tU,8ǀ8}0tU0<ǀ<0u}4tU4@ǀ@U8DDt Ƃ#f w fƀƀxE$f$G ??t9uuxǀƀƀƀD$  TD$PD$$E8tfD$ D$D$ D$D$@$E8tǀLk [ǀL JD$ D$D$ D$D$<$ǀL [^_]ÐUE8u lUD$( D$D$ D$hD$`$ǀl UD$( D$D$ D$D$d$ǀlC UU`U dUhǀl D$( D$D$ D$hD$`$ÐUƀǀǀǀǀǀƀǀǀǀ]UUE D]UWVS<} u)‰) ȉ+y  A=wqvǀA)yB ~ǀǀ% ~~E‰;t-EEԍEЉ$ ǃ<[^_]ÐU8EHEEUE܉$U8EHEEE EEEE܉$U8EHEEE EE܉$U$t$É Џto~kt&̏̏~:ǀBƀЏďƄǀȏЏt؋$t$]U]u}ljUE싰ȏ)9tM싑ďۉ؉M ďffҏďȏt)ƂЏǀ̏8!ËE싐ďÉM ȏE]u}]UWVS ]s\$CD$$<t <lCD$D$$S C Mr"Utu\ďďD$$ ďD$$ǀGǂď8uAďďD$$ǀǂďǂǀďǀ̏ƀЏfǀҏƀN]ڸ~~~}ԏďN~#%ǀ9EM܋E@EӋM܀9w7EԸMਫ਼BtEӃ)E}~E}ǀďN~ ]ǀV~Q9uCҏtи!Ƅ$ǀE)9t$ Ƅ$;E,[^_]Uh]u}]u}EED$t$\$D$ & ED$D$E$U tǀƀԏǀƀԏǀďǀ؏ǀ܏ǀ]u}]UWVS\]u}EED$t$\$D$  ED$D$E$U tǀƀԏǀƀԏǀǀďǀ؏ǀ܏ǀ\[^_]U8]u}ljUE܋ȏ)9M܋ďۉ؉M ďUďȏt)ƂЏǀ̏hD$ED$$UU K$uǁkǁď\uǁǀh9ǁ*@B<ǁ9ďǁ kǁ _ǁ $Aď8!ËE܋ďÉM ȏE]u}]UWVS} EE|$E$ >Mr$Utvu\ďďD$$ ďD$$ǀIǂď:uAďďD$$ǀǂďǂǀďǀ̏ƀЏfǀҏƀN]ڸ~~~ԏt)ďN~GAǀ'ďN~ǀE)9E[^_]UWVS|E D$U$ ؏})؏]\$ E D$؏ؘD$U$\$E$ ܏})܏܏$EU $xuǁ$ǁďuǁǀhǁ@B<ǁ}9ď~hǁ\H 1ǁ %ǁ $ď)9GE[^_]UU@tСƀЏƀяƀҏƀӏƀ<ƀ=UU:UB$R ;B  D$B D$$ buOǀCiR ƀU;|%4D$$ǀDUԏuƀԏED$$U$UfЏt ȏ ǀȏȏ ~Y8@@t*ǂȏǀǀ@ #ǂȏcǀ@Ĵ U ~#ǀȏ'ǀ@Ĵ UՏtt8@ u$׏uǂǀD 4Ƃ֏ǀǀ4 ǀDUՏtďď~%YǀDƀ֏U~+t t ǀDU$Uӏu;}CD$$ǀ@ƀ֏UfЏu ȏ ǀȏȏ~\2ǀD!ǀ@ǀƀ֏ǀ4U~xǀǀD ǀȏǀďǀ@ ǀU=ǀD,ǀďǀȏǀ@ ǀU;,~zU~St tAǀD ǀ@2 ǀUUDtСƀՏ֏@ű ǀD4=t(=t!=t=t= t&t=u ǂ ǂǀ@ű ǀUVS]uUU  tFuuܝuߡ08׏D$D$$ƀ<ƀ=ƀЏƀяƀҏƀӏƀԏƀՏƀ֏ƀǀ@ǀ(ǀǀǀ,,F@t_D$$ǀȏǀǀ@R ǀD)FtK{ǀǀ@ǀDq ǀFtǂD ǀ ǂDǀ@ ǀȏǀďǀbNtUǂDǀďǀȏǀ@ ǀF% $ǂ@ǂ2ǂKvǂejǂ^ǂ/ RǂFǂ^:ǂ'.ǂ4"ǂOǂxi ǂF7t ǂD ǂDP qǀ@[^]UD$$"7ǀ@ǀDUt t4ǀ@Z ǀ ;|MUяt ȏ ǀȏЏt ď ǀďȏD$$-ǀ@ǀtǀǀ3 t ǀDX >ǀDq 2ď ~D$$;|+UՏt8@t ǂDUԏt;~US<׏$̏׏D$$p׏u% €u Hsfǀ@hǀD J=t~3 tu@ǀ@ǀDǀƀ֏ǀ4D$$rҏ׏$̏tǀǀǀ@1 D$$׏D$̏D$$)~;8@ }[]USҏ׏$̏D$$׏D$̏D$$tǀǀǀ@k ;|[]US<׏$̏׏D$$p׏tOǀ@ǀƀ֏ǀ4 \D$$usǀȏǀǀ@R 3[]U~MD$$ǀǀ,DǀDP $USt tqǀ@ǀD ǀďD$׏D$̏$4;|[]ÐUVSu<у8BtBt-׏tuƒ ƒ tȃȃ Uf[^]UU t  fǀf]U$t$։9t 9t9Ћ$t$]U$t$ƉER yoɉȃ``u0%=u"uЀC|ЀCmt tЀCTtJ@tEЀC;t1 t,ЀC"yt@tЀC$t$]U]u}u ]U ȃ vft&@t1uB9E~!tuf 9E~UtIuEf@6/B9E~"t@ut U؃usU ˋ8$tC<//yL @svcR]u}]UWVSē~ē;ƂՏ̓;ȓtau2ǀȓēE/Uē*ǀȓfǀē;ēE)9E [^_]UUǀГu!ȓǀ̓ȓ̓ $pfǀ@fǀfǀ@fǀǀԓ ǀԓZ ǀԓmfǀؓ@fǀړǀԓ @ǀԓ/ǀ̓ǀȓǀ̓{UE D$E$Гvǀԓ ǀГUE D$E$Гv(ǀԓZ ǀГU]u}u] 4|$ D$ؓD$4$\$|$4$\$\$ D$D$%4$D$ D$@ؓ$]u}]UWVS ÜPГ ۃ4t$ D$L$E$D$t$E$t$ D$D$E$t|$t$E$|$|$ D$D$E$ۍD$D$ D$i%D$E$|$|$ D$i۔ۉ\$E$E D$ |$D$E$D$ D$@$D$ D$@$Ĝ[^_]ÐUUxtUƀȏ]Uƀɏ]Uƀʏ]Uƀˏ]Uƀӏ]Uƀ̏]Ut ƀ`ƀ͏]Ut}`ƂΏ]Ut ƀ`ƀϏ]Ut}`ƂЏ]Ut ƀ`ƀя]Ut ƀ` ƀҏ]U`t5ǀdǀďǀt =ӏt4ƀǀdǀďǀt ]U/*~0֏D$6D$$ǀx UǀD$ D$D$$ǀxǀUȏtǀďUȏtzǀ D$ D$҉T$$ǀx$ǀtǀďUD$$$ǀtǀďUǀD$ D$D$$ǀxr UˏtuUďttСƀȏƀʏƀˏƀ̏ƀ͏ƀΏƀϏƀЏƀяƀҏƀӏƀ`U$U]uu>V^V t-֏D$FD$$V 6 ƀ6Vt-7D$FD$$V ƀC vE~ t8֏D$6D$$ǀx qj;t$D$ D$D$$ǀx[ Ftt0uBD$$@D$$*D$$D$$~t$ $V ǀt ǀ]u]Uȏ6t|tFǀx. D$ D$D$$ǀ2֏D$‰D$$ǀx  UȏtUȏt=t-7D$‰D$$ǀx U^D$D$ D$D$$USʏt6D$$`f^ǀt ˏt"fǃ^Vǀt ӏtǃdǀď`tPfǃ^`ǀdǀďǀt +ď;d~ǃt fǀ^[]USʏtOD$$`fǀdǀďǀt ˏt;fǃǀdǀďǀt ӏtǃdǀď`t]fǃfǀ^t`ǀdǀď9ď;d~+ǃt fǀfǀ^"[]UD$$ƀjD$l$luwtFǀD$ D$D$$ǀxD$$AuKǀD$ D$D$$ǀxr IǀD$ D$D$$ǀxr U tD$$B:D$ D$lD$k$pƀiǀxp ǀǀtUՏD$$AU~:D$ D$lD$k$pƀii@tufD$ D$D$$ǀx$ǀtǀďHƂɏlT$ D$D$$ɏt9ǀx$ǀt ǀďǀx u7D$ D$D$$ǀx yu[D$ D$D$$tǀǀx%ǀx D$$%UȏtUD$$UՏuD$$ƀՏUhuƀhD$$@Uƀȏƀʏƀˏƀ̏ƀ͏ƀΏƀϏƀЏƀяƀҏƀӏƀ6ƀƀƀ`ǀdƀɏƀiƀjƀkUuUutiǂxǀt D$ D$D$$D$$$suMǂxD$$$ǀtǀďtgǂD$ D$D$$ǀxǀǀtyQǂD$ D$D$$ǀxǀtMǂ D$ D$ D$$ǀxD$$$ǀtǀďǂyNǂD$ D$D$$ǀxǀtgǂ D$ D$ D$$ǀx$ǀtǀďUȏtUUD$$&USď~ʏD$$ ǀD$ D$D$$ǀx$ǀtǀďD$$ ɏƀɏD$ D$D$$ɏt ǀx(ǀǀx ǀt$ǀďXD$$%=t&uD$$ D$$%[]USď~ʏD$$ƀk$taǀD$ D$D$$ǀx$ǀďe$ǀtǀď9uD$$ D$$%[]USď~ʏD$$ƀk$taǀD$ D$D$$ǀx$ǀďJǀ9uD$$ D$$%[]USď~ʏD$$ƀk$taǀD$ D$D$$ǀx$ǀďJǀ9uD$$ D$$%[]USď~ufʏuD$$ uD$$ yuD$$ Y uD$$ 9 uD$$ D$$%[]USď~ʏu$D$$ ɏtmƀɏǀD$ D$D$$ǀx$ǀďTD$$%9uD$$ D$$%[]USď~ʏdbD$$ƀk$tsǀD$ D$D$$ǀx$ǀt ǀďǀD$ D$D$$ǀx$ǀtǀď$ǀtǀďD$$ ɏtmƀɏǀD$ D$D$$ǀx$ǀďUD$$%:uD$$ D$$%[]UUU lD$ED$$UǀlǀpƀhƀԏƀՏÐU/*~DǀD$ D$D$$ǀxUȏtUǀD$ D$D$$ǀx ǀDǀD$ D$D$$ǀxUSËuSD$ D$ÉD$$$ǀtǀďhlD$ L$ÉD$$D$$$ǀtǀďǀx[]U/*~ UȏtYtFD$ D$D$$ǀx ǀ U? t7ǀ D$ D$ D$$5ǀD$ D$D$$t ǀxM ǀxD$$$t ǀt< ǀtǀďUSď~̏tҏt/D$$D$$Ώt(D$$ǀЏǀxƀɏtIǀlD$ D$D$$ǀtGǀlD$ D$D$$ǀtD$$D$$ǀďʏD$$u$D$$ƀk$t|tsǀD$ D$D$$ǀx$ǀtǀďǀD$$ƀk$t|tsǀD$ D$D$$ǀx$ǀtǀďǀD$$ ɏtmƀɏǀD$ D$D$$ǀx$ǀďVD$$%;fuD$$ D$$%[]U8]u}ď_T~ʏ¡ ED$$ED$$  Éy 1Ѓy ǀD$ D$D$$ǀx@D$$]u}]ÐUhƀԏD$$ǀD$ D$D$$ǀxǀďǀt` UȏǀxƀɏtIǀlD$ D$D$$ǀtGǀlD$ D$D$$ǀtǀďUSď~ʏq#D$$ƀk$tdǀD$ D$D$$ǀx$ǀďƀɏǀlD$ D$D$$ǀx$ǀtǀď9uD$$ D$$%[]USď~ʏD$$ƀk$t|tsǀD$ D$D$$ǀx$ǀtǀď ǀ D$$ƀk$tytpǀD$ D$D$$ǀx$ǀtǀďJǀ9uD$$ D$$%[]USď~ЏD$$ƀɏǀlD$ D$D$$ǀxǀtD$$ǀďʏD$$u$;fuD$$ D$$%[]Uď~ϏtpD$$D$$ǀǀx ǀďǀtUSď~яt/D$$D$$ΏtCD$$D$$ǀ͏WD$$D$$ǀ D$ D$ D$$ǀxǀt ǀďt,D$$ǀ}ǂ D$ D$ D$$ǀxD$$ǀt ǀďЏtlD$$ǀD$ D$D$$ǀxG ǀtϏƀǀD$$tltԏu fDǂ D$ D$ D$$ǀt ǀďSǂD$ D$D$$ǀxG ǀtʏD$$u$VD$$ƀk$t|tsǀD$ D$D$$ǀx$ǀtǀďǀ};D$$ƀk$t|tsǀD$ D$D$$ǀx$ǀt$ ǀďƀɏǀlD$ D$D$$ǀx$ǀtǀď9uD$$ D$$%[]Uʏt= u3fED$$ED$$ÐUS]M "8u Q"C8t Q"C8uQ"C8uQ"C8uQ"C8uQ"C8uQ"C8uQ"C8uQ "C 8uQ "C 8uQ "C 8pQ "C 8_Q "C 8NQ"C8=A"S8[]UWVS u ]}uUT$t$$UڸUuUB"FtiCB"Ft CN t C vAUB"FtC*tC t Ct&tCCuUDVu [^_]ÐUU]UtE D$E$UUp]UUl]U8EOEEE EE܉$ U8E@EEE EE܉$ U8E_EEE EEEEEEEE܉$ U8E`EEE܉$ UE$ UED$D$$UUƀiD$ED$$UUED$D$$UUS]E D$$$[]US]E D$$$[]UhEED$D$ D$D$ EĉD$D$E$D$ D$D$$B@US]ǀU $ED$E D$$[]ÐU]U]UWVS] E}u ЈCtG?C7CD>NCEt5?CN@u!?CN@u ?CNEt5?C@u!?C @u ?C Et,?C @u?C D9?C Et ?CE t ?CE@t ?C;M}-u)CF~BD9u[^_]Uǀu<ǂǀ 0ǀGǀu9ǂǀ 6ǀOǀdǂǀ 0ǀGǀ4ǀ86ǀ<Oǀǀ $ k,DŽ0ǂǂǂ ǂ(ǂǂ$ǀ,9a]UWVS } E\ E AAQQ)É\\ AQQ)É]\ \AA QQ)T~E;D~9|Ew}G G $W(ǀ& ǀKǀǀ ǀ0ǀ8(ǀ\ǀdǀǀCǀǀ"ǀiǀǀ (ǀ0ǀ8Cǀ\ǀd:ǀ~ok,ǂǂǂ ǀ(9~ G [^_]U]u}} _OMAAQQ)É__AQQ)4w_ AA QQ)W ~5;G~+9}'G G ~ $W(ǀG ]u}]Uǀ/ǀǀ ǀ(ǀ0ǀGǀ$ǀ,ǀ4]Uƀƀ|ǀJǀǀǀǀǀ ǀ]UU t.E<D$$USE9~ËE D$D$$؃[]US]|tM`~D$$"-D$E D$$؃[]UE|-8C$x@$Ƃ}ǀƀ~~uƀ}}t"~uD$$ ƀ~ƀ}ǀvƂ~ƀ}ǀR}t"~uD$$"ƀ~ƀ}ǀUWVSE EE U싒%=u 7 E샸 ~ ǀ3U;uut$$ MǁǀѨDu 7 E)9Ut$$[^_]UU|tXǀƀ}ƀ~ǀD$D$$`UWVS]ۡ<)D$E D$ D$D$ U$<T$<D$$<D$؉D$+E$<ÉQ9uthtu%~3k,D$<$9ҡ<U,5(E AAQQ)É(5 U AQQ)É 50E AA QQ)É0S ~`;(~U;0~M$~;,~;4#~$$ǀ ǀ5U AAQQ)É5E AQQ)É5U AA QQ)É~6;~+;~# ~$ ǀ|tE D$U$[^_]ÐUUDE D$$DUǀD]UWVSƋ ՘Ȁ່FȀAFtFAFȀFȀD SFt#FȀFȀD FD SFt#FȀF ȀD F D Ft5<^ @F u ؃Ȁ@D F D Ft FF t FF@t FЀ~t7 @FB~t"ѻD3AڃF9|[^_]UStǀDǀD`Xƀ`a\]\$$0\$$0t[]UWVS,MþEu E`D$D$$p`XtƄ`u~ ʻƄ`~9u}EEUԘu E:MكE`E}~ Et릃EU9Uu}~[~lj)E܅uƄ`~!`M܈`9Uu2`\,[^_]UVS ] uǀDԘD$ED$$EED$ԘD$$EЉEԘE՘ٺ [^]UWVS u }X3XX;\u`X)9uE [^_]U8]u}ӉΉǡǀDǀLǀH$<ǀDS= fǀ@<&ǀP5ǀTrǀD< fǀ@ ǀP5ǀTrǀD< Efǀ@<&ǀPeǀTǀD< fǀ@ ǀPeǀTǀD< fǀ@ ǀPTqǀDX; fǀ@<&ǀP5ǀDX; cfǀ@ ǀP5ǀDX; 2fǀ@ ǀP ǀDX; fǀ@<&ǀP ǀDX; fǀ@<&ǀPX8ǀDX; Bw$EE`Xƀ`ƀaƀbƀcd\ƀԘ$EE2ƀԘ%EEƀԘ(EEƀԘ)EEƀԘ*EEƀԘ+EEƀԘ!EEƀԘ"_EEeƀԘ#@EEFƀԘ-՘EEu՘@EEt;~t5}@~/՘՘FU)‰ЃEEEE}t ED$ԘD$M $EЉE]ԘE՘كU߉#} ՘AAAFA~tD2D F9BPИEED$ԘD$И$U҉U ИԘИ ИE ԘИǀD:ИǀDǀD]u}]US]UM <Bw,$tېu Mr[]UWVS}u HD$ PD$HD$<$H~HfV9ut$t$ D$ @D$<$DvǀD[^_]UWVSu} HD$ PD$HD$4$HHfW9uHD$ TD$LD$4$LHfW9u|$|$ D$ @D$4$D? vN<7HD$ TD$LD$4$Ly[^_]US]E D$$9~ǀD[]ÐUE$pUE$|UE$tU8EUEUME܉$UU]UU]U+y]U+y]U]U]UE D$E$UE D$E$UWVS|u~E0~0uED$$…tDDž~4E EEMMMDYMM9uU9|[^_]UWVSlu] ~#MfDQ9utfdE~,0~0ED$$9ىl[^_]U(]u}}E+E+EG9ىH{9~RED$E D$4$6D$E ؉D$)$?)ED$E D$<$E x9u]u}]U]u})؉x)؍;M~}9}OE D$\$4$6E ؉D$D$)$?)E D$\$<$ {9utƀ]u}]U]u}})؉x)؍~Ƃt 9}&t -ƀ9}OE D$\$4$6E ؉D$D$)$?)E D$\$<$ {9u]u}]U(]u}}E+E+EG9"~ى{ƀ9~RED$E D$4$6D$E ؉D$)$?)ED$E D$<$E x9u]u}]UWVS}]Mu ǀǀǀpǀ|tǀxƀƀu8A u6B w$ ɍvt t ǀ}? ǀ> t t ǀ@ ǀ@ Ot$L$\$ ED$ED$<$(t$L$\$ ED$ED$E $[^_]ÐUWVS<]u +ƒy9}ӿ~9fJ%uljt-EUEEEEЉ$<[^_]U]U]UE$UE$UVS +%=B]\$$ ܴt*\$$+%=~9tD$ D${D$$$$؋]u]US$ExV4tEÅt2%$Åxn$Åx[E=xV4D$ D$D$$$$FE=xV4tftLD$D$ D$D$$y$]$OD$D$ D$D$$y$ $]\$D$ D$D$$f}t*\$D$ D$ D$$ $0$[]US$fEftLD$D$ D$D$$y$]$OD$D$ D$D$$y$ $]\$D$ D$D$$f}tW\$D$ D$ D$$MD ÉD$L$$d$fE]\$D$ D$ D$$\$D$ D$D$$fM\$D$ D$D$$\$D$ D$ D$$MD ÉD$L$$d$[]U8]u}}u =t$|$$ ED$D$ D$D$$=u=u,D$D$ D$D$$t$|$$Å=ta=uXD$D$ D$D$$D$D$ D$D$$\$$\؋]u}]US$fE$x]\$D$ D$0D$$fe\$D$ D$0D$$fE\$D$ D$4D$$fE\$D$ 0D$D$$$[]UD$$U$D$ $U8$ED$D$ D$D$$f!UWVS{t&t,&{t&t &E$[]UWVS\}ExV4 D$ @$Elx up@L@@xt$EFEPdž$FD$D$H]߉$0D$\$$ED$EЉD$D$ D$QD$d$!ED$EԉD$D$ D$}D$d$!EԋE EЉD$D$D$ D$D$d$t dž@D$$$$H^D$4$D$4$FFF FF F$FFF(F,F0F4F8F<F@FPFTFDFHFLFXF\F`FdFhFlFpFtFxdžF|dždždžD$hD$ $dž<D$D$$dždždždždždždždždždždždž FFF FF F$FFF(F,F0F4F8F<F@FPFTFDFHFLFXF\F`FdFhFlFpFtFxdžF|dždždžD$hD$ $dž<lD$D$$dždždždždždždždždždždždž- FFF FF F$FFF(F,F0F4F8F<F@FPFTFDFHFLFXF\F`FdFhFlFpFtFxdžF|dždždžD$hD$ $dž<lD$D$$dždždždždždždždždždždždžp FFF FF F$FFF(F,F0F4F8F<F@FPFTFDFHFLFXF\F`FdFhFlFpFtFxdžF|dždždžD$hD$ $dž<D$D$$dždždždždždždždždždždždžƆFFF FF F$FFF(F,F0F4F8F<F@FPFTFDFHFLFXF\F`FdFhFlFpFtFxdžF|dždždžD$hD$ $dž<D$D$$dždždždždždždždždždždždžFFF FF F$FFF(F,F0F4F8F<F@FPFTFDFHFLFXF\F`FdFhFlFpFtFxdžF|dždždžD$hD$ $dž<D$D$$dždždždždždždždždždždždž2FFF FF F$FFF(F,F0F4F8F<F@FPFTFDFHFLFXF\F`FdFhFlFpFtFxdžF|dždždžD$hD$ $dž<lD$D$$dždždždždždždždždždždždžuFFF FF F$FFF(F,F0F4F8F<F@FPFTFDFHFLFXF\F`FdFhFlFpFtFxdžF|dždždžD$hD$ $dž<lD$D$$dždždždždždždždždždždždžFFF FF F$FFF(F,F0F4F8F<F@FPFTFDFHFLFXF\F`FdFhFlFpFtFxdžF|dždždžD$hD$ $dž<D$D$$dždždždždždždždždždždždžD$4$V5D$4$@D$4$4$4$4$>1E 4$VE؉$$uuE؉$u4$V $2E}u 4$V}ExV4{ uD$C$C E=xV4tl-K!KvwJft&X\t&F$F$vw)$&$ o&$$vw$Gf$t&h&t&MCACv>)t&">)t&w)' K(&h0h0vw?)f2t&{Ct&o9u9uvw&9p&qaT/`;yftV;ywy@ ft6f&Bǂh0xB2ǂًx{BǂًxXBǂًx5gB+ǂxDB3ǂ x!Bǂ9pxEUT$ML$|$Å&4EU9?GMH@ @UP@1ǀExV4x1uG;@GE=xV4tt$$8t$$)‰Ѓ [^_]UVS u ExV4Etet uEE=xV4t<D$D$ D$!%D$0$<$dž<dž84tFcttw9trʾGÉ$<t\i@D$D$$i@D$<D$D$ D$!%D$0$Ecu$É$UcE+McEED$ $uc}$ccDžpDžtD$D$D$ D$)%D$0$=t&D$D$Uc$D$pD$D$ D$T%D$$$D$tD$D$ D$T%D$M0$tt;pteD$D$uc$D$pD$D$ D$T%D$0$D$ED$D$ D$c%D$U0$u MǁD$ED$D$ D$n%D$U0$u MǁEǀǀǀ|EEEED$U$EME$É$E|UD$D$$MD$|D$D$ D$6%D$0$M9uT$|D$$T$D$U|$MǁcECcE]\$ $EǀcEpUtSE\$$MǁcD$ED$D$ D$}%D$0$!ED$D$D$ D$%D$U0$ǀD$ED$D$ D$%D$$$tf}yfǀfǀMǁHD$HD$D$ D$%D$$$u EǀHED$]\$D$ D$%D$U0$ETEEut$M $ED$E$ETEEt$U$D$\$D$ D$%D$M0$\EED\$$`f\$$@fDžlD$pD$D$ D$%D$`f$!pD$tD$D$ D$%D$`f$upDžtpt9s9\$'$D$lD$D$ D$%|$$tTD$hD$D$ D$%|$$uhp;htDžl9YlEuE$…yE;EtD$M $XETUED$u4$u8E;EtD$4$ETEED$E$UǂDD$ED$D$ D$}%D$0$D$]\$D$ D$%D$$$u9D$\$D$ D$%D$u0$tSETEE]\$E$u0D$U$ETE\$M $&[_c g$lËu@lF0^t$D$G<$ٍ[E)ǃ uD$D$R<$ٺ%E4)D$D$R$%E)D$D$R$&E)D$D$R$&Ea)D$D$R$&E;)D$D$Z$*&E)D$D$Z$6&E)Í D$D$Z$B&E)ÁluU@$Mǁ@D$EhCD$D$ D$N&D$$$u udžhCD$ED$D$ D$%D$U0$t$E\+EEED$M $D$]\$D$ D$h&D$u0$tc}t]E^ED$4$fǀED$\$D$ D$h&D$0$EU<EED$$MǁƀƀDžGPhonfDžKeD$D$$uD$$C1LƅM8sgfff)ʍJ0L҉)Ѓ0MƅND$4D$D$ GD$D$$…tƄGƅ{D${\$D$ D$r&D$U0${ƅ{D$\$D$ D$r&D$M0$D$|\$D$ D$&D$u0$t9ƅD$\$D$ D$&D$0$ƅzD$z\$D$ D$&D$U0$zƅzD$\$D$ D$&D$M0$D$|\$D$ D$&D$u0$t9ƅD$\$D$ D$&D$0$UB-MȤǁ̤ǁФǁl[^_]Ãƅ/U]UU:t<u]U]US$]$ED$$E$[]UEt@$US]t@$xt@$‰Ѓ[]UWVSlEUM:t&UU\tƃ\tu)Ã@j\$D$}<$D}tED$|$U$ED$ED$U$uE8tU2Egl[^_]UWVS,]} uE &E 8t-}u $tOEtHËE 8uٍED$ED$$x$ED$ ED$ED$E$yEE,[^_]UWVS]} uE &E 8t6}u $CtUt E 8t ׸[^_]UWVS,]} uE &E 8t-}u $tXEtQËE 8uٍED$ED$$u-Mt&EUD$ ED$T$ $uE,[^_]ÐUStu[]UU/'~& d w8&Q&C&5&w@v'vt&wB&w ui& @uJ]A'tpwtFu"=& tC4' t6&/&(&!&' ('9']Uw$ fJ'6R'/['(c'!u'z'' '']UPw1$Df'@'9'2'+'$'D$D$'$  UWVSÉ׉M 9s,)ЉE>D$D$'$Ã;uuE[^_]US yػ-%i=?B/h T$L$ ÉD$D$'$`c=/ T$L$ ÉD$D$'$`-CT$L$ ÉD$D$'$``[]U yع-iq=qu!T$ D$D$($#D$T$ D$D$'$USÉхt9s (((9(c 9sB'v:D$ MbȉӺD$D$!($8D$ ̉ȉӺD$D$.($[]U]u}MAfEfMfUu }D9D5` fT st&:fNtt&2t&2ftD f &sfN3&If  fsfs&s1f &1fSs3fj6&3s3'f'&! !GW0fr3f4 &r$f$&"##fr/%f&&sr.f5.&I*$*f()f3r+f',&rCAf'A&/@fqBf3C&qd/afa&ePKPJt&&JAGfEGEf:7FZqDAHSZIBq4M5M&K4Lfqs5Nf5O&p a[f5[&IWTWfQ1PUfpSXfVY&pQ^fvh^&\k5]fcp`g_f_`&Cp-`mfUGm&g`hgGdfdbUcfoUefPf&oUjfDjj&hUifomkf fl&o&f,vIxfxfpmqfCooyfyft&#o*[0v#,nft&i0t&n&fUBD$D$:(M $nuFD$D$>(} <$nUB$D$D$X(M $nuFhmD$D$h(} <$YnUBhmD$D$(M $0nuFD$D$8} <$nUBD$D$XM $muFD$D$x} <$mUBD$D$M $muFD$D$} <$mUBD$D$M $amuF$D$D$(} <$7mUB$D$D$(M $ mu Rx DFata FModeF ActFive!fF l} Tx DGata GModeG ActGive!fG lE Clea@rdow@n! lU CleaBrdowBn! (B RemoBte rBequeBst) BUlMAD$D$(u 4$3l}GD$D$(E $lU CarrBier BPresB ent!fB kM CarrAier ALostfA ! Aku RetrFainiFng! F k} RetrGainiGng! G (ReGmoteG reqGuestfG) G`kE Fast@ Par@amet@ er X@chan@ge! @+kU FastB ParBamteB r XcBhangBe! (BRemoBte rB equeB$st) B(jM RateA RenAegotA iatiAon! Aju RateF RenFegotF iatiFon! F (ReFmoteF reqF uestfF$) F&\j} FallGbackG iniG tiatGed! G.jE Fall@forw@ard @ init@iate@d! iU CleaBrdowBn inB itiaBted!fB iM V.21A HDLAC prA eambAle dAetecAted!fA iuF=$\f((} PeriGodicGal dG etecGted G+iE Phas@e re@vers@ al d@etec@ted @hU SignBal sBtartB detBectefBd BhM SignAal eAnd dA etecAted Ahu S FdeteFctedfF rh} S~ GdeteGctedfG PhE J4 @dete@ctedf@ .hU J16 BdeteBctedfB hM Rf dAetecAted A gu RfBaFr deFtectF ed g} Ja dGetecGted G gE D$ Ef ED$D$(E $ogE D$ Ef ED$D$)U $5gM S/S~A to AacknA owleAdge AJa dAetecAted A fu Jd' FdeteFctedfF f} R deGtectGed fE R~ d@etec@ted @ fUBD$D$M $rfuF0D$D$%)} <$KfE J' @dete@ctedf@ )f>)E>)|K)EhK)YW)EEW)6a)E"a)j)EEt!w))))Et#)}))}x)iEt#)}M)>j)+u#*}**}-*Et#>*}I*S*}]*Etf*}xsq*g|*tXu*}xC*7u(*}x"*|* T$D$:(U $E 8 t E 8 uXcXDuf DuD$D$*$;t;u9c‹MAD$D$*u 4$b}GD$D$*E $bUBD$D$*M $buF$D$D$*} <$bUB$D$D$4M $XbuFD$D$X} <$6bE 1200@bps @trai@ ningf@ bU 2400Bbps BtraiB ningfB aM USB1A detAectefA d Aau SB1 F@ 12F00 dF etecFted Fa} SB1 G@ 24G00 dG etecGted GbaE S1 d@etec@ted @ BaU V22 BinitBiatiB ng VB54 lBoop B2 teBst aM V22 ArespAondiA ng tAo V5A4 loAop 2A tesfA t A"`u V22 FdeteFctedF looFp 2 FtestF altFernaF tingF$ 0 aF(nd 1fF, ``} DataGModeGm loG cal GdigiGtal GloopGbackG tesG$t stG(artefG,d G.`E Data@Mode@m lo@ cal @digi@tal @loop@back@ tes@$t fi@(nish@,ed _U DataBModeBm reB moteB digBitalB looBpbacB k teB$st sB(tartB,ed L_M DataAModeAm reA moteA digAitalA looApbacA k teA$st fA(inisA,hed A0^u DataFModeFm loF cal FanalFog lFoopbFack F testF$ staF(rtedfF, ^} DataGModeGm loG cal GanalGog lGoopbGack G testG$ finG(ishefG,d G.5^E Data@Mode@m lo@ opba@ck s@elf @test@ ena@ bledf@$ ]U V34 BhalfB dupB lex BcontBrol BchanBnel B PPh B$deteB(ctedfB, ]M V34 AhalfA dupA lex AcontArol AchanAnel A MPh A$deteA(ctedfA, 5]uV +u+D$D$ЃD$ L$D$|} <$\E V8 (@V34 @Phas@ e 1)@ det@ecte@d AN@S to@ ne \U V8 (BV34 BPhasB e 1)B detBecteBd ANBSam B V\M V8 (AV34 APhasA e 1)A detAecteAd CMfA \u V8 (FV34 FPhasF e 1)F detFecteFd JMfF [} V8 (GV34 GPhasG e 1)G detGecteGd CJfG [E V8 (@V34 @Phas@ e 1)@ det@ecte@d CIf@ ^[UB$D$D$M $4[uF u D$KD$} <$ [D$D$E $ZUBT$ %D$D$DM $Zu ReceFivinFg V3F 4 PhFase F2 L1F sigFnal F zZ} ReceGivinGg V3G 4 PhGase G2 L2G sigGnal G 7ZE V34 @Phas@e 2 @ star@ted @ ZU V92 BPhasBe 1 B secoBnd ABNSamfB YMA$D$D$u 4$Y} V34 GPhasGe 3 G starGted GzYE V34 @Phas@e 3 @ fini@shedf@ JYU V34 BPhasBe 4 B starBted BYM V34 APhasAe 4 A finiAshedfA XuFD$D$} <$XUBD$D$M $XuFD$D$ } <$XUBD$D$TM $dXu V34 FSeamFlessF RatFe ChFangeF UpdFate F TimeF$out F(X}GP0H1P2H3P4H5P6H$7+xu#+'+xu#+++x u/+3+x u#+0D$41D$02D$,3D$(4D$$5D$ 6D$7D$|$\$L$ T$D$u 4$V}GP8H9P:H;P<H=P>H$?+xu#+'+xu#+++x u/+3+x u#+8D$49D$0:D$,;D$(D$?D$|$\$L$ T$D$u 4$U}iG` D$D$7+E $UUiB` D$D$U+M $UuiF` D$D$s+} <$uUUiB` D$D$+M $OUu^GP} <f>GsPE V32 @rang@ing @ star@ted @EPU V32 BrangBing B finiBshedfB PMAD$D$u 4$O&} wjG$th+Y+R+K+D+=+6+/,( ,!,,$, ,,5,D$D$E $ZOUBt#&M V34 AphasAe 2:A retAurn Ato VA8, lAook A for A$ANSafA(m A*Nu V34 FphasFe 2:F retFurn Fto VF8, lFook F for F$ANSaF(m anF,d seF0nd cF4learF8downfF< RN} V34 GphasGe 2:G retGurn Gto VG8, sGend G ANSafG$m G&NE V34 @phas@e 2:@ ret@urn @to V@8, s@end @ ANSa@$m on@( holf@,d @.MD$D$8U $MMAD$D$>,u 4$aM}GmD$D$K,E $:MU V92 BTONEBq deB tectBed MM V92 ATONEAq seA nt Lu V92 FQTS FdeteF ctedfF L} V92 GQTSbGar dG etecGted GLE V92 @ANSp@cm s@ tart@ed lLU V92 BANSpBcm fB inisBhed B>LMAƒtDtuVD$D$T,u 4$LD$D$l,} <$KD$D$,E $KD$D$,U $KD$D$,M $KuV$h}GD$D$hE $^KUBD$D$M $IUBD$D$O-M $IuFD$D$h-} <$HUBD$D$M $HuFQD$D$-} <$HUB*D$D$-M ${HuFD$D$-} <$YHUBD$D$-M $0Hu V8 cFall FmenuF sigFnal FCM dFata:F9} V8 jGointG menG u siGgnalG JM GdatafG:E@@UR D] ;t ] ;u@~<޿DD$D$-4$9@uԋ@sf DG-}u-D$D$-E $GUBD$D$ M $FuFvD$D$@ } <$FUBOD$D$l M $FuF(D$D$ } <$yFUBD$D$ M $RFuFD$D$$!} <$0FUBD$D$.M $FuFD$D$-.} <$EUBD$D$H!M $Eu~t-} PCM GMu-lGaw cG odinfGg GEE PCM @A-la@w co@ dingf@ kEUJQ)kd)L$ T$D$l!U $-EMAD$D$D.u 4$ E}GD$D$Y.E $DUBD$D$n.M $DuFD$D$.} <$DUBD$D$!M $DuFD$D$!} <$aDE@HURLMI PuvT3 U2L]ֹ EE}GuE\$ED$t$PT$LL$ Ht$D$!} <$CMQËuV FX Uˉ{ ڋXwEE\$4}ˉ|$0F D$,FD$(FD$$FD$ E։D$ED$TD$PT$LL$ Ht$D$L"} <$BE Conn@ecti@on e@ stab@lish@ed! f@ BUBD$D$.M $Bu~B} HDLCG flaGgs dG etecGted GQBUBD$BD$BD$B D$BD$ BD$D$"M $ BuFAD$D$.} <$AUBt(M RingAbackA detA ectefAd At!u BusyF detFectefF d Ft$} ReorGder GdeteG ctedfG t7U SecoBndarBy diB altoBne dBetecBted B t%M BongA tonAe deA tectAed @u StutFter FdialF toneF detFectefFd F@}GtU v.21B sigBnal B tM v.22A sigAnal A @tu v.23F sigFnal F t} v.25G sigGnal G yU v.32B sigBnal B tM v.34A sigAnal A tu B103F sigFnal F ?} B212G sigGnal G ?UB?D$D$.M $?.u~u.D$D$.} <$P?.Uzu.D$D$.M $!?u CallF waiFtingF tonFe deFtectFed >} CallGWaitGingDG etecGtor:G CASG tonGe deG tectG$ed >D$VD$0#E $|>U Low BFreqBuencB y InBterfBerenBce dBetecB ted B$2>My%>A$`iu DialFing FcompF letefFd F=} No dGialtGone G =E Bong@ tonf@e @ =U No bBong BtonefB =MAD$D$.u 4$j=}GD$G D$ GD$D$#E $:=.Uzu.D$D$/M $ =uFj<~tD$D$#/} <$<D$D$:/E $<UBt- <vtYt&<M I/O AstatAus RA x daAta bAuffeAr ovAerflA ow @<u I/O FstatFus TF x daFta bFuffeFr spFace F avaiF$lablfF(e F*;D$D$Q/} <$;E AT P@rofi@le c@ hangf@e;UBD$ D$f/D${/M $z;u ReseFt haFrdwaF re W;}GD$D$#E $5;UB$D$D$/M $ ;uF/xD$D$/{$ڋ}Gt&r=uTT$D$#E $:T$D$$U $:T$D$0$M $w:T$D$T$u 4$[:}G  $iE LAPM@ tim@eoutf@ ":Uz:B$iM LAPMA disAconnA ecteAd (rAemotAe reAquesA ted A$discA(onneA,ct) A09u LAPMF disFconnF ecteFd (lFocalF reqFuestF ed dF$iscoF(nnecF,t) Q9} LAPMG disGconnG ecteGd (cGonneGctioGn faG iledfG$) G&9E LAPM@ dis@conn@ ecte@d (p@roto@col @erro@ r) 8U LAPMB disBconnB ecteBd (cBomprBessiBon eB rrorfB$) B&k8M LAPMA disAconnA ecteAd (iAnactAivitAy tiA mer A$expiA(red)fA, 8u LAPMF disFconnF ecteFd (rFetryF faiFled)fF 7} LAPMG estGabliG shedG conGnectGion G7E LAPM@ V.4@2 OD@ P de@tect@ed _7U LAPMB V.4B2 ADB P deBtectBed .7M LAPMA UnkAnownA ADPA detAectefAd A6u LAPMF MNPF fraF me dFetecFted F6} LAPMG patGternG detGectiGon fGailefGd G|6UB u&t.M LAPMA ErrAor: A unknAown A6u LAPMF ErrFor: F N400F retFriesF excFeedeF d; rF$etraF(in fF,orcefF0d F25} LAPMG ErrGor: G buffGer oGverfGlow Gz5E LAPM@ Err@or: @ fram@e to@o lo@ng B5U LAPMB ErrBor: B bad BframfBe B5MA $iu LAPMF tesFt paF ssedfF 4} LAPMG tesGt reG quesGt igGnorefGd G4E LAPM@ tes@t al@ read@y in@ pro@gresf@s @R4U LAPMB tesBt noB t suBpporBted B4M LAPMA tesAt faA iledfA 3D$D$/u 4$3}G D$ GD$D$x$E $3UB D$ BD$D$$M $3uFD$D$/} <$UBD$D$/M $uv `U э\`PЃt<.`AD$ D$D$/$SUPWfC(э\<tJ<w<t&< t\< fx`BD$D$ 0$v`AD$D$0$N`FD$D$#0$&`GD$D$/0$????fC)UNM(Cэ\cct[Cftdt&L=tc=foyt&=tQ=fubRSABMfCE)CZDM)RUI)JDISCfC)<UA)4FRMRfC)&XID)CTESTfC) ????fC)߉эt - эAUR\0~ Dž\0\0MA D$D$<0$9\`0ΉD$D$A0u 4$B0}50G$iUBD$D$$M $ 0uFD$D$%} <$/UBD$D$8%M $/uFD$D$`%} <$/ExtIU LAPMB tesBt fuB nctiBons BsuppBorteBd fB B"Q/M LAPMA tesAt fuA nctiAons Anot AsuppAortefA d A"/u~tJ} LAPMG selGectiG ve rGejecGt suGpporGted G G$.E LAPM@ sel@ecti@ ve r@ejec@t no@t su@ppor@ ted @$k.U LAPMB ComBpresB sionB typBe V4B2bisB/.M LAPMA ComApresA sionA typAe V4fA4-uFtnt"--} LAPMG comGpresG sionG disGableGd G G |-E LAPM@ com@pres@ sion@ xmt@ onl@y @ @ 9-U LAPMB comBpresB sionB rcvB onlBy B B ,M LAPMA comApresA sionA enaAbledA A A ,uFD$D$%} <$,UBD$D$%M $o,uFD$D$%} <$M,UBD$D$&M $+,uFD$D$(&} <$ ,UBD$D$P&M $+u~+F$$j} V42bGis EGncodG er: GTranGsparGent GmodeG actG$ive G(+E V42b@is E@ncod@ er: @Comp@ress@ed m@ode @ acti@$ve 2+U V42bBis DBecodB er: BTranBsparBent BmodeB actB$ive B(*M V42bAis DAecodA er: ACompAressAed mAode A actiA$ve *uFt4} V42bGis EGrrorG : unGknowfGn GD*E V42b@is E@rror@ : un@defi@ned @esca@pe s@ eque@$nce @()U V42bBis EBrrorB : coBdewoBrd sBize BoverB flowfB$ )M V42bAis EArrorA : unAdefiAned AcodeAwordfA b)uF D$ FD$D$x&} <$9)UB D$ BD$D$&M $)u~)Ft&$@j} V44 GEncoGder:G TraGnspaGrentG modGe acG tivefG$ (E V44 @Enco@der:@ Com@pres@sed @mode@ act@ ive @$^(U V44 BDecoBder:B TraBnspaBrentB modBe acB tivefB$ (M V44 ADecoAder:A ComApresAsed AmodeA actA ive A$'u~w F$\j} V44 GErroGr: uG nknoGwn 'E V44 @Erro@r: u@ ndef@ined@ esc@ape @sequ@ encef@$ ?'U V44 BErroBr: cB odewBord BsizeB oveBrflofB w B"&M V44 AErroAr: uA ndefAinedA codAeworfAd A&u V44 FErroFr: oF rdinFal sFize FoverFflowfF o&} V44 GErroGr: hG istoGry bGuffeGr ovGerflG ow )&UB D$ BD$D$&M $&uF D$ FD$D$ '} <$%UB $pjMy%A$ju MNP FdiscFonneF ctedF (reFmoteF reqFuestF ed dF$iscoF(nnecF,t) O%} MNP GdiscGonneG ctedG (loGcal GrequGesteG d diG$sconG(nectfG,) G.$E MNP @disc@onne@ cted@ (co@nnec@tion@ fai@ led)f@$ $U MNP BdiscBonneB ctedB (prBotocBol eBrrorfB ) B"\$M MNP AdiscAonneA ctedA (coAmpreAssioAn erA ror)fA$ $u MNP FdiscFonneF ctedF (inFactiFvityF timF er eF$xpirF(ed) F,#} MNP GdiscGonneG ctedG (reGtry GfailGed) G u#E MNP @esab@lish@ ed c@onne@ctiof@n @:#U MNP BnegoBtiatB ion BfailBed. BFallBbackfB "MAtpt*u MNP FErroFr: uF nknoFwn "} MNP GErroGr: bG uffeGr ovGerflGow z"E MNP @Erro@r: f@ rame@ too@ lonf@g @?"U MNP BErroBr: bB ad fBramefB "MA D$ AD$D$X'u 4$!}G D$ GD$D$'E $!UB RD$T$ DD$D$'u 4$!} MNP GLT fGrameG hasG invGalidG seqGuencG e nuG$mberfG( 9!UB D$ BD$D$ (M $!u MNP FNACKF. SeF nd LFA twFice F D$D$R0} <$ Ex @t&$jMAD$D$b0u 4$ }GD$D$|0E $` Uzt?M MNP AdataA optA imizAatioAn enAableAd  u MNP FdataF optF imizFatioFn diFsablFed F }t7E MNP @comp@ress@ ion @enab@led f@ U MNP BcompBressB ion BdisaBbledfB BZMAD$D$@(u 4$8}GD$D$`(E $UBD$D$(M $uF$j}Gt [E V80 @disc@onne@ cted@ (re@mote@ req@uest@ ed d@$isco@(nnec@,t) nU V80 BdiscBonneB ctedB (loBcal BrequBesteB d diB$sconB(nectfB,) B.M V80 AesabAlishA ed cAonneActiofAn Au~t*} V80 GErroGr: uG nknoGwn E V80 @Erro@r: b@ ad f@ramef@ rUB D$ BD$D$(M $IuF D$ FD$D$(} <$ D$D$0E $UBtUt'BD$D$ )M $uF D$ FD$D$@)} <$UB D$ BD$D$|)M ${u~nF$k} OverGlay:G loaG d beGgin G6E Over@lay:@ loa@ d enf@d @ UB D$ BD$D$)M $0u~t0D$ }G D$D$)E $0Uzt0D$ MA D$D$$*u 4$n} OverGlay:G repG lay GdonefG >UBD$D$0M $u~t*} SW rGing GdeteG ctorG onE SW r@ing @dete@ ctor@ off@Uzt8M CallAer IAD ciA rcuiAt acAtivaAtedzu CallFer IFD ciF rcuiFt deFactiFvatefFd<} CallGer IGD ciG rcuiGt reGset E DTAS@ det@ectef@ dUz B$,kM OHLMA resAet aA fterA linAe reAversAal.u CP sFtartFed aF fterF linFe reFversFal.T} FSK GCID GstarG ted GafteGr DTG-AS.GE FSK @CID @star@ ted @afte@r RP@-AS.@U FSK BCID BstarB ted BafteBr riBng.M OHLMA offA becA auseA FSKA CIDA endAed.eu OHLMF offF becF auseF FSKF CIDF timFed oF ut.} FSK GCID GtimeG d oufGt.GE OHLM@ off@ bec@ ause@ DTM@F CI@D en@ded.@ U OHLMB offB becB auseB DTMBF CIBD tiBmed B out.B$eM CP sAtartAed.Iu CP sFtopefFd.F *}G$`kUB$kM CallAer IAD erA ror:A marAk siAgnalA errA or u CallFer IFD erF ror:F tooF manFy maFrk bF its F$betwF(een F,messF0age F4wordfF8s F:D} CallGer IGD erG ror:G mesGsageG tooG lonG g, G$trunG(catefG,d G.E Call@er I@D er@ ror:@ mes@sage@ too@ sho@ rt UB D$D$L*M $~D$D$0u 4$b}GD$D$t*E $@U CallBer IBD: pB ossiBble BchanBnel BseizB ure B$receB(ivedfB, MAD$D$*u 4$}W BD$$BD$ BD$BD$BD$BD$BD$ D$D$*E $gUZB ٍ{fƄ{{L$D$+u 4$'}_G ٍ{&Ƅ{{D$D$0U $MIduv h} CallGer IGD: uG nknoGwn mGessaGge: G} ~9ΉhD$D$-$huԋdt E } ?uUBJ$lM CleaAr CoAnnecA tionA StaAtistAics*uF$D$D$2} <$UB D$ BD$D$-M $uF D$ FD$D$2} <$UB D$ BD$D$-M $uF D$ FD$D$2} <$WUBD$D$3M $5uFD$D$*3} <$UBD$D$-M $uFD$D$.} <$UB D$ BD$D$@3M $uFD$D$]3} <$UBD$D$v3M $buF D$ FD$D$3} <$9UB D$ BD$D$3M $uF D$ FD$D$3} <$UB$D$D$3M $uFD$D$3} <$UB$D$D$3M $quF$D$D$3} <$FUBD$D$4M $D$D$&4u 4$} V92 GdataG chaG ngedfG E Spea@kerp@honef@ : @8t E U :uMQ$Lmu AudiFo ToF LinF e UnFderrFun a} AudiGo ToG LinG e OvGerrufGn G-E Line@ To @Audi@ o Un@derr@un U LineB To BAudiB o OvBerrufBn BMAD$ D$D$@.u 4$} AudiGo ReGset G MAD$ T$D$84u 4$_}GD$G D$ GD$D$p.E $2-u Uzt!uFD$ L$D$M4} <$]u}]U]u}] u$ ۉ؃ ED$$ t$ $|$$ ]u}]U]u] $  ]\$$ ED$$ t$$ ]u]U]u] $  ]\$$ $ Ét$$ ؋]u]US] \$E$ڃ []U]u] \$E$؃ ]u]U]u] $ ۋE É\$$ $ Ét$$ ؋]u]UVSuD$$9u uո[^]U]u}] }$ ۉ؃ ED$$ ‰D$ $t$$ ]u}]ÐUUftfffBtBB]UEf=w ]UU Ef=w ]U]U]U]U]U]U]U]U]U]UE$U$i4U]u}U] 1>t2>z$Njt;f_~uf=~D$\$$ff~@f f>f>~3f;u-f#D$$w4]u}]U+EUUS]f)[]UUU=t $U}t=u$U$UU=u $UD$ D$D$$$UE D$E$UE$ÐUEw]$mOHt&<5f,%ff ]UEt}Av==xvtWt&Ptrt+ukt&Gt2uUNfE>f5.f%ff]UEw4$m&vf ]UU#5,/3L/(/..G5u415tn5|a4tTu274t=4|04t#4t44 25V5]UE8uxu x]Uƒ8u xuxtJBBuED$ D$CD$$uEf$[]UWVS ]}u |x*$uxtډ;t˃ [^_]UWVS ]CC}u x+tux $tʃ [^_]US$]ED$ D$CSD$$Eƒf9t.fU‰D$ D$CSD$$$[]ÐU=y f  f]UEt{Љ%=t=t!@fD@ff fЃ0 t0t!fD@ff f]Uf]U]Uf]U]Uƒ]U]Uf]UE]UED$D$s5$$Utt,@t# $5ft==u4=u+t"~ft2~)=u fFt"t$5ffUSf؃`=u=ut ~@t$5Ã[]U$t$utatt &t tC&5t &t $t$]USE؄y = ؃tt u*$($$ $؃8t9u(t&t18t;$f7$)$$ $t$ $@t []US]=y #tu []UE=y PfEt$1ED$$UUE wO$m$;$v+$v$v $fUWVS }u t#ftC$f9t'ƉD$<$ [^_]U=y f7=u=uD$$UEwP$nfqj&\t&QJ&D$R$D$B$$ D$D$>$D$D$V$D$A8$?D$D$A8$[]U]u]u u$$]u]UWVS ƉӍE$ۃ )wD$@8$tڋE$D$@8$ [^_]U]u}uU Ɔdždždžfz$fz8B(B<BLBlB\$h08D$@$D$A8$?D$D$A8$D$A8$D$D$A8$D$4$9ú+t8D$D8$D$D$D8$>D$D8$ȀD$D$D8$dž džD$<4$u,dž džD$<4$.D$D$<4$D$|4$f=GAtf=IStD$~4$f=RtD$~4$f=Rdž dždždždždždždždždžFDFHdžFLF,FhF8dž<5dždždždždždždždždžFDFHdžFLF,FhF8dž<dždždždždždždždždžFDFHdžFLF,FhF8dž<4$uD$4$D$$%Ɔdždž0dž`dždžk`$dž $lj$t u4$ 耉  4$4$(u4$jD$ 4$f D$D$ 4$4$ÉD$D$ 4$dž Ɔ]u}]UWVS u} E$v)؃w$9uڋE$$9 [^_]ÐUWVSNj%ƃ0LtA`Dt"uߋǀǀǀǀ \D0C`DD0"u׋ǀǀǀǀ[^_]U]U]U]U]U]UEUT$U T$$U]U]UE]U]U]UMt E D$ $UWVSuUtY] ]׉E)9vӉ\$D$ $غ)lju[^_]UVSË<$ƨtƃt$<$t1D$<$<$t,D$<$D$2$@$%D$@$[^]USÀt>D$8-$tt@$[]U]uÉրtu tI<$tD$<$D$<$]u]US]u#D$$ƃؤ[]U]uD$`E D$]$8t$ \$D$0E$D$`t$E$]u]UET$UWVS u$؋$$9uB9w) + [^_]U]uu] 4$+yk}]u]UE$UWVSu$Ë$ بtƆ$؋$$9uBE9w)EU싾CÃ$9tÉD$$$@Ã$9tÉD$$E)E[^_]UVS ]ǃ u4$D$ $D$$D$$D$$D$$D$$$D$$$D$$D$ $D$$4$$$ [^]UVS Íu4$$D$$$%D$$$D$$ $%D$ $D$ $D$$4$ [^]UEUS]$A$[]US]$D u$[]U]u]u ‰D$$ tu$$]u]U8]u}} E$<$Ɖ<$ÍE$)ډ1)‹9})щʃ~A<$É<$D$ \$D$<$<$<$<t.ƇD$ D$D$<$]u}]US]<$u"uФu$E D$$[]US]D$D$$S8ǃ$$(<$t $t&$ǃǃǃ[]UWVS ƍ<$f)؃wD$u<$ <$ [^_]US]tE $ӉЃ[]UVSu]Bu@$tBÉD$E $D$D$ӉЃ[^]UWVS ÉփDž~upt&Xu>$D$$@$%D$@$?Fwnt$$D$>$u D$D$>$@$D$@$@$ D$@$x t$$D$>$ D$D$>$D$D$V$uA/Љ3!@$^ [^_]US]tAD$$ƃD$V$%D$D$V$[]U]u]u u$2t$D$$$X]u]UE D$D$TE$U]u}}@$ÃJ %EuQtN@$u0D$8-$t0$ut؀D$@$t؀D$@$t3<$%D$<$؃D$@$t+$%D$$t+$%D$$}t]u}]U]u}uU ƆƆdždžfz$Zfz8OB(B,B<BLBlB\D$24$@$dž @$t&D$<4$%u dž S uJ@$t'D$<4$t dž  OD$|4$f=GAtf=IS/&D$~4$f=RtD$~4$f=Rdž dždždždždždždždždžFDFHdžFLF,FhF8dž<džIdždždždždždždždždžFDFHdžFLF,FhF8dž<dždždždždždždždždždžFDFHdžFLF,FhF8dž<dž4$uD$4$%Ɔdždž0dž`dž dž k`$dž@$%=uED$8-$t0$Ɔ $ lj$t u4$       L4$(u4$74$4$u dž F8]u}]UWVS u} E$ )؃w4$9uE$4$9 [^_]ÐUE]U勐D=u]U]U]U]USE] tfDu[]U]U]U]UU]UE@!]UE<!]USUt$vD[]UE<‸;t ]U]U]U]UVSu] EftDfNfu[^]US] EftUJfBfu[]US] u!tD$$ƃ[]U]U]U]UUE D$$UE]U]UUEt9u]UWVS }M ] ]‰UMU苇)9vƉ~M% 9u鋇EӺE)t| [^_]U]U ]u]$ƺ)Љ ;r ǃ ]u]UE$U勀D%+yv ]US]M 9Bu:yu4ALAA Q‰PA UATt L$$Ѓ[]UWVSuLTU<H;P9LPL9)Ѓu B9tE`ED$4$Kσ*)R)P T*)R)P ˃*)R)PT)R)P4$ËU +yvDžT`TD$4$D%غk}ļ[^_]US] u,u#D$$ƃؤ[]U]u}u}]D$`E )ЍBD$$4D$ \$D$04$ uS9r 9vD$`4D$<$!4D$`D$)ЍB$]u}]US]$(  ǃ $$[]US]Xt$ЋE D$$[]US]U %=u $ $[]U(fEMeU E ЈED$ ED$ED$E$$#EU(MfEEEE% E%E ЈED$ ED$ED$ $U(ME EUE ‰U%E ЈED$ ED$ED$ $UVSudžt$$4$ u0D$D$4$D$D$4$$$$dždž[^]US] 1 BfB0fB /BB  0 BfB0fB /BB ǃ  0 $$$(u$[]US] tj$'=uT$D%H[]U(]u}] $lj$Ɖ)1)ы9})ʉс~/t$ |$D$$$$<$t.ƃ$D$ D$D$$]u}]U(MEUE  ‰U%E ЈED$ ED$ED$ $U(ME EE% E%E ЈED$ ED$ED$ $U(MEE% E%E ЈED$ ED$ED$ $U(ME EE% E%E ЈED$ ED$ED$ $U(ME fEEEE% E%E ЈED$ ED$ED$ $UWVSu D$ D$0D$$D$ D$1D$$qD$4$tD$4$t<@ 0D $`lj$t u4$ 0P   DDD ꀃ=u؋fD DD 逃=u؉4$ f=uZD$04$D$f0%D$4$D$f1%D$4$4D$ 4$D$f0%D$4$4$%4$D$ 4$[^_]U(MfEE E%E ЈED$ ED$ED$ $U(EEU E% EeD$ ED$ED$E$EU(MfEE EU E% ЉE%E ЈED$ ED$ED$ $EU(MEfEEEU E% ЉE%E ЈED$ ED$ED$ $USÅuMD$$D$$$D$$xSD$$SLx T$$ uD$$CD$$f D$D$$D$D$ $$$ǃǃ[]U]u]u u$2t$D$$$]u]US]\&D$%$$%D$$=U0tZ=&0tS=9t&ufD$$'=@fD$$ǃX=@=@w=9-}=&0=U0t&ǃǃǃǃǃǃǃǃǃCDCHǃCLC,ChC8ǃ<ǃƃsǃǃǃǃǃǃǃǃǃCDCHǃCLC,ChC8ǃ<ǃƃǃǃǃǃǃǃǃǃǃCDCHǃCLC,ChC8ǃ<ǃƃ D$$ƃ$ƃǃǃ0ǃ`ǃ ǃ ǃ$ǃ$tu'ǃ~ ǃX[]ÐUS]D$$D$D$$D$D$$D$D$$[]UEƀHƀDƀAƀ,ƀ ƀAƀ2ƀ]UE$UU} %D$$U]u]$t$$t$$]u]U]u]$Ɓt$$t$$]u]UVSu} thD$4$f D$D$4$D$D$4$D$D$4$5D$D$4$D$D$4$[^]U2]UWVS ]} D$$ƍtf f"tf f"t+wtKt*u;,f&+f%ff%f f%f tf f"tf f"D$D$ $ƉD$D$$ [^_]UE} tD$,D$$D$D$$U]UUE =t=u/f=u%BhǂXxSu f]U} tD$D$ $D$D$ $U]u}u4$ǁ} u_ u4FhD$4$%D$D$4$t|$4$E u.D$4$D$D$4$ӉfÉD$4$ u \$4$f=t{} uu ulD$4$D$^4$%D$D$^4$ӋD$^4$f D$D$^4$Ӌ]u}]UD$$US$]U vftfuuKfED$$ED$ED$ ED$D$6x$(%fEUT$D$$$[]UWVS,]D$D$ D$D$/x$ED$$ED$}|$ ut$D$:6x$ED$$ED$t$ |$D$:6x$ED$$ED$|$ t$D$:6x$ED$$ED$t$ |$D$:6x$ED$$ED$|$ t$D$:6x$ED$$ED$t$ |$D$:6x$ED$$ED$|$ t$D$:6x$E $ED$t$ |$D$:6x$E D$ $ED$|$ t$D$:6x$E D$ $ED$t$ |$D$:6x$E D$ $ED$|$ t$D$:6x$E D$ $ED$t$ |$D$:6x$ED$$ED$|$ t$D$:6x$ED$$ED$t$ |$D$:6x$ED$$ED$|$ t$D$:6x$ED$$ED$t$ |$D$:6x$ED$$ED$|$ t$D$:6x$ED$$ED$t$ |$D$:6x$ED$$ED$|$ t$D$:6x$ED$$ED$t$ |$D$:6x$,[^_]UVS]ǃD$D$ $D$@D$$01 D$D$$D$D$$D$$D$$t)=vD$ D$$D$D$$D$D$$D$$$ǃ? ǃ D$D$$ƃ$[^]ÐUS]D$$D$D$$D$D$$D$@D$$[]UVS]D$ $ƃHƃDƃAƃ,ƃ ƃAƃ1ƃ ƃ Sƃ!-ƃ"Rƃ#eƃ$vƃ%:ƃ' wa$oƃ&AQƃ&BHƃ&C?ƃ&D6ƃ&E-ƃ&FD$$fyƃ'+ƃ&Gƃ( ƃ)Lƃ*-ƃ+Rƃ,eƃ-vƃ.:fttuƃ/Afƃ/Bƃ/Cƃ0[^]U]U]u]$t$$t$$]u]U]u]$Ɓt$$t$$]u]U2]UWVS u} D$4$tf f"tf f"tt!u*f$ffuf" tf f"t f vf"%=t%=wt9=t=fu)"ȃ ȃ` ȃ@%=u ȃÃ˃D$D$ 4$ÉD$D$4$ [^_]U]U]UUE =t$=uBf=u8ǂXBh%ǂXfǂVff]U]u}u4$ǁ} u_ u4FhD$4$%D$D$4$t|$4$E u.D$4$D$D$4$ӉfÉD$4$ u \$4$f=t{} uu ulD$4$D$^4$%D$D$^4$ӋD$^4$f D$D$^4$Ӌ]u}]US]} uChD$$[]UVS]D$$<pD$$uD$$x ;~f=trff vW fJD$$ǃǃXCh$D$$fVt fǃVfVV[^]US]=t+=v$ƒЃ[]U} tD$D$ $D$D$ $US$]U vft fuvKfED$$ED$ED$ ED$D$E6x$(%fEUT$D$$$[]UWVS,]D$D$ D$D$/x$ED$$ED$}|$ ut$D$`6x$ED$$ED$t$ |$D$`6x$ED$$ED$|$ t$D$`6x$ED$$ED$t$ |$D$`6x$ED$$ED$|$ t$D$`6x$ED$$ED$t$ |$D$`6x$ED$$ED$|$ t$D$`6x$E $ED$t$ |$D$`6x$E D$ $ED$|$ t$D$`6x$E D$ $ED$t$ |$D$`6x$E D$ $ED$|$ t$D$`6x$E D$ $ED$t$ |$D$`6x$ED$$ED$|$ t$D$`6x$ED$$ED$t$ |$D$`6x$ED$$ED$|$ t$D$`6x$,[^_]UVS]ǃD$D$ $D$@D$$01 D$D$$D$D$$D$$D$$t)=vD$ D$$D$D$$D$D$$D$$$ǃ, ǃ, ƃǃ$[^]UVS]} D$D$$D$D$$D$D$$D$D$ $\$uO)D$D$ $D$F$$u&)=vt&)=t&vD$D$$5D$D$$D$D$$[^]ÐUS]D$D$h$D$D$p$D$$D$D$R$D$D$^$[]US]uƃ ƃHƃDƃAƃAƃCƃ9ƃ7ƃ,ƃ ƃAD$~$4ƃ  ƃ! ƃ"Sƃ#-ƃ$Rƃ%eƃ&vƃ':D$l$% t/ tM= t&t"= u;&"ƃ(20ƃ(3'ƃ 5ƃ(1ƃ 5ƃ(2ƃ( ƃ) ƃ*Lƃ+-ƃ,Rƃ-eƃ.vƃ/:ƃ0 ƃ1u []UE$UED$D$d$UED$D$d$U2]U]UEU ʉL$T$$U]US]D$D$v$SfS D$D$x$SD$D$v$fSD$D$v$[]UWVS,uD$D$ D$D$k6x$D$D$$4$D$D$ D$D$6x$:ÉEfTtKD$4$E쿐6D$ED$ ED$|$x$f~vE4$ED$ED$ ED$D$6x$VdfED$D$ ED$D$6x$ED$D$$4$`ÉEfTtFD$4$ED$ED$ ED$|$x$flvA4$ED$ED$ ED$|$x$VmEfEf D$D$ D$D$6x$D$D$$4$,[^_]UWVS,u] D$D$ D$D$6x$ E}D$b4$%?D$D$d4$D$b4$u)=vD$f4$?fUf%fED$ED$ ED$D$6x$ft ftfu.D$D$ D$D$6x$E}D$b4$%?D$D$d4$D$b4$u)=vD$f4$?fUf%fED$ED$ ED$D$6x$,[^_]US]M =tF=t B ChuyuoASA SAS$JAuAD$$1u,Q?fA f D$D$d$[]UVS]u t>tD$D$d$WD$D$d$<tD$D$d$D$D$d$t%t;uOD$D$d$4D$D$d$D$D$d$xS uUD$D$d$tD$D$d$D$D$d$xS~uUD$D$d$tD$D$d$D$D$d$D$$D$f$[^]UWVSudždžfEtD$D$V4$fED$~4$tfED$^4$00E D$D$^4$D$4$E D$D$^4$D$4$E D$D$^4$4$D$D$p4$D$D$R4$D$D$$4$u4D$D$\4$D$D$`4$D$D$\4$D$D$$4$D$D$`4$D$D$b4$D$D$j4$D$D$h4$D$D$f4$D$AD$f4$D$D$$4$D$D$Z4$D$D$z4$E@؉\$D$^4$D$4$E D$D$^4$D$4$D$/D$h4$D$4$D$D$h4$D$D$h4$D$D$h4$D$4$D$b4$u)=ED$n4$f tEwcvEx w;D$h4$f%?  D$D$h4$2D$D$h4$D$D$h4$D$D$F4$D$D$z4$Ɔ 4$[^_]U} tD$D$ $D$D$ $UWVS }D$D$d<$D$D$d<$D$D$d<$D$b<$D$D$d<$D$b<$u)=vD$f<$Ѓ%?=tf vˆ<vD$PD$d<$D$TD$d<$D$D$d<$D$D$d<$D$D$d<$$P؉ѺD$D$r<$֋$P؉ѺD$D$t<$ց} u4$H@D$D$t<$D$D$p<$$UD$<$<t<t<uƇ01Ƈ02Ƈ03ƀ  [^_]UVSu} "D$D$z4$D$D$^4$D$D$h4$D$24$D$D$p4$D$D$R4$D$D$z4$ D$D$^4$D$4$ D$D$^4$D$4$pۉ\$D$^4$24$4$D$4$xSD$4$[^]UVS]Ch} u>Ɖ$u)= vCht%u‰D$$D$D$`$[^]ÐUWVSE‹%ƃ`ǁLtA`D| "uߋUǀǀǀǀ \|DD` "u؋Uǀǀǀǀ[^_]U]U]U]U]U]U]U]U]U]UE]U]U]UMt E D$ $UWVSuUtY] ]׉E)9vӉ\$D$ $غ)lju[^_]USË $D$ $D$$D$$D$$D$ $D$$[]UE$US]MtE $ӉЃ[]U]uu]tBÉD$E $D$D$ӉЋ]u]US]tAD$$ƃD$V$%D$D$V$[]UE D$D$TE$U]u}Ɖ׉tPÉD$аꀁ$D$D$ӉЋ]u}]U]uD$`E D$]$8t$ \$D$0E$D$`t$E$]u]U]u}u@$ÿ tt؀D$@$t؀D$@$t34$%D$4$؃D$@$t+$%D$$t+$%D$$]u}]UWVS}$ƻ%$ƃeu fy։PUEA9tAD$$$fyA9tAD$$U)‹E)؍[^_]UVSu$ $eu+fyۉP)ʋ+[^]U]uu] 4$+yk}]u]UE$U8]u}} E$<$Ɖ<$ÍE$)ډ1)‹9})щʃ~A<$É<$D$ \$D$<$<$<$]u}]UE@$UWVS Ƌ<$lj4$@$D$ <$D$<$D$<$<$u닆@$| D$<$ۉ\$<$D$<$D$4$\$<$D$ 4$<$D$D$ [^_]USÅu$u$D$$x T$$D$>$ D$D$>$D$D$V$t#B$u2&|&[]U$t$]u u!/u$t$]US]ǃtԤ *$$($t&$ǃǃǃ[]U]u}uU Ɔdždžfz$fz8B(B,B<BLBlB\+dž @$t0D$<4$D$<4$t dž S uJ@$t'D$<4$t dž  #D$|4$f=GAtf=ISD$~4$f=RtD$~4$f=Rdž dždždždždždždždždžFDFHdžFLF,FhF8dž<dž?dždždždždždždždždžFDFHdžFLF,FhF8dž<dždždždždždždždždždžFDFHdžFLF,FhF8dž<4$uD$4$%Ɔdždž0dž`dž0džk`$dž $0lj$t u4$!       w4$(u4$4$4$tQ&tjD $ÉԤfy =džH  džԤЋ]u}]UWVS u} E$f)؃w4$9uE$4$9 [^_]ÐUS Ӌ E[]US Ӌ []U]U]UE]UE]U]UE u0tƀ0]U]U]U]UE]U]U]UE$U ]uu] 4$+yk}]u]UMt E D$ $US]D$$%D$D$$[]US]D$|$ D$D$|$D$$D$|$%D$D$|$[]UVS]D$ $D$D$ $D$D $ %D$D$D $D$ $fỳD$D$ $$D$D $Ɓt$D$D $D$ $%D$D$D $D$ $D$H $ƃ‰D$D$H $D$ $%D$D$H $D$ $[^]US] t=L$te.%D$D$T$BL$t(.%D$D$T$[]USӋH$u[]UVS]u L$fyL$fxf.‰΀ ЉD$L$[^]U(]u]u4$$D$$4$D$$]u]U(]u]u4$$D$$4$D$$]u]U(]uu]$$D$$$$$ D$$$]u]U(]u}u=$ǃfx Ã]$$̀D$$$$$%D$$$t.%D$4$$ǩ tQ$D$ 耉$D$ $tX$D$耉$D$$؋]u}]UWVSǀ ]$$$$$$$$j$R$0:$0"$0 $0}<$$ D$$<$<$$ D$$<$D$0耉$$<$$D$$<$D$$<$$ D$$<$[^_]UJUEƀ0(u tU(]u}ǀu %tb uYE$<$Ɖ<$ÍE$)ډ1)‹9})щʃ]u}]UWVSÍu4$L$D$L$4$4$$̀D$$4$4$$%D$$4$}<$4$$%D$$4$4$$%D$$4$D$ $D$$4$$%D$$4$4$$%D$$4$<$[^_]UEUS$ÍE$H$u"T$H$E$$[]UWVSuUtY] ]׉E)9vӉ\$D$ $غ)lju[^_]US]u$ D$D$>$D$D$V$ t$D$D8$ t! D$D$D8$ D$D$D8$D$8$D$D$8$D$D8$ t!%D$D$D8$%D$D$D8$D$8$D$D$8$D$$ D$D$$[^]U(]u}u} uf]$$ D$$$p]$$%D$$$u dž]u}]US]tHD$$ƃD$V$%D$D$V$ƃ$[]USӋɉ $[]UVS utԤ 4$4$(4$t$dždž  $$]$H$%D$H$$ [^]U(]u}u] ƆƆ0Ɔ$dž(Ɔ,fdž.f;f{$f{8$PT u$QT8n$qT$3:CD$C$ CC(C<CLClC\džt:džD$<4$D$<4$u dž uOt2džD$<4$udžJ8 ]$D$D $ǁ |$D$D $D$4$%D$D$D $D$4$D$$D$$$aD$|4$f=GAtf=IS=D$~4$f=RtD$~4$f=RdždždždždždždždždždžFDFHdžFLF,FhF8dž<Ɔ%odždždždždždždždždžFDFHdžFLF,FhF8dž<D$~4$%dždždždždždždždždžFDFHdžFLF,FhF8dž<D$~4$%4$uD$4$F,%Ɔdždž0dž`dž dž k`$dž $ lj$t u4$  4$(uu4$4$D$D$P4$D$D$R4$.%D$D$T4$4$t4 Ԥfy džfn ]u}]UWVS u} E$t&)؃w4$9uE$4$9 [^_]U]u}}u.LJLJФLJD$<$$t)+ؤ=Ƈ$ u1<$D$ <$D$D$<$wOD$`E D$]$4t$ \$D$0<$D$`t$E$]u}]ÐUS]D$$D$D$P$D$D$R$D$D$>$[]U]UE$U]u]D$D$\$$t$$t$$]u]U]u]D$D$\$$Ɓt$$t$$]u]UUE} t>tt(̠2PD$D$\$US]} tkD$D$N$D$D$P$D$D$R$D$D$T$5D$D$P$D$D$R$[]U]u]} tdD$D$P$$Ɓt$$t$$D$D$R$5D$D$P$D$D$R$]u]UWVS u} D$b4$tf f"tf f"tt!u*f$ffuf" tf f"tf f"%=t*=w t9=t=fu)"ȃ ȃ` ȃ@%=u ȃÃ˃D$D$\4$ÉD$D$b4$ [^_]U]u}]u tMt ?ȃttu! utt t $9ftD$D$\$]u}]US]M B}wuD$T$$[]U]UE =t=u(f=uE@hff]UWVSu} t7%D$D$\4$4$ uhf=tWE$ÿ!4$tf )؃vӋE$FhD$D$\4$4$Ǩt ߉\$4$\$4$؉\$4$ u \$4$} t@D$b4$%D$D$b4$fFh D$b4$%D$D$b4$D$f4$`D$D$f4$D$f4$%D$D$f4$D$b4$%D$D$b4$[^_]UVS]D$^$<@pD$b$uD$d$x ;~f=tXff v= f0D$$$ǃCht[^]U]u}uD$|4$D$4$D$~4$fISffLD$b4$D$Z4$ƆAƆCƆ9Ɔ7Ɔ,Ɔ ƆAƆ1Ɔ  Ɔ!SƆ"-Ɔ#RƆ$eƆ%vƆ&:Ɔ( ЃwU$ pƆ'AEƆ'B<Ɔ'C3Ɔ'D*Ɔ'E!Ɔ'FuƆ(+Ɔ'GƆ) Ɔ*LƆ+-Ɔ,RƆ-eƆ.vƆ/:fttuƆ0AƆ0BƆ0CƆ1Ɔf f]u}]UWVS,}D$D$ D$D$/x$E<D$<<$ED$ut$ ]\$D$6x$E>D$><$ED$\$ t$D$6x$E@D$@<$ED$t$ \$D$6x$EBD$B<$ED$\$ t$D$6x$EFD$F<$ED$t$ \$D$6x$EHD$H<$ED$\$ t$D$6x$ELD$L<$ED$t$ \$D$6x$END$N<$ED$\$ t$D$6x$EPD$P<$ED$t$ \$D$6x$ERD$R<$ED$\$ t$D$6x$ET<$ED$t$ \$D$6x$EVD$V<$ED$\$ t$D$6x$EZD$Z<$ED$t$ \$D$6x$E\D$\<$ED$\$ t$D$6x$E^D$^<$ED$t$ \$D$6x$EbD$b<$ED$\$ t$D$6x$EdD$d<$ED$t$ \$D$6x$D$~<$%@ EjD$j<$ED$\$ t$D$6x$ElD$l<$ED$t$ \$D$6x$EnD$n<$ED$\$ t$D$6x$EpD$p<$ED$t$ \$D$6x$ErD$r<$ED$\$ t$D$6x$EtD$t<$ED$t$ \$D$6x$EvD$v<$ED$\$ t$D$6x$ExD$x<$ED$t$ \$D$6x$E|D$|<$ED$ut$ ]\$D$6x$E~D$~<$ED$\$ t$D$6x$,[^_]UWVS]ǃD$D$V$D$@D$@$D$D$F$ED$>$€Ɓ|$D$>$D$$t$D$>$D$($D$>$t+E=vD$(D$L$D$D$N$D$D$P$D$D$R$D$$ǃ ǃM ǃ$[^_]ÐUVS]D$$D$D$P$D$D$R$D$>$D$D$>$փ[^]UE$U]u]$t$$t$$]u]U]u]$Ɓt$$t$$]u]U]u]u} t;D$D$j$tt;P/#D$D$j$D$D$\$]u]UVSu} D$l4$f D$D$l4$D$D$P4$4$Á\$4$\$4$D$D$R4$5D$D$P4$D$D$R4$[^]UWVS u} D$b4$tf f"tf f"t'wtD&tu3%f"v(ff f tf f"tf f"%=t+=wt@=ft!=u0&"ȃ ȃ` ȃ@%=u ȃÃ˃D$D$\4$ÉD$D$b4$ [^_]U]u}]u t_t Qȃt'wt:&tu)f  tt t $9ftD$D$\$]u}]U]UUE =t=u%f=uBhxSu f]UWVS u4$ǃ߃}  u6FhD$L4$%D$D$L4$2D$D$$4$D$,D$d4$ft ߉\$4$\$4$ u.D$L4$ D$D$L4$D$D$d4$D$D$$4$f=t-D$^4$%D$D$^4$Ӊf؉\$4$ u \$4$f=t{} uu ulD$4$D$^4$%D$D$^4$ӋD$^4$f D$D$^4$Ӄ [^_]UVSuf=D$^4$ffvD$4$\D$^4$%wD$D$^4$ӋD$^4$f D$D$^4$D$^4$y <<軑 @gfffD$b4$u5D$Z4$tD$d4$x A~t؃[^]UD$$U(]u}uD$|4$D$~4$fGAffRD$b4$fEƆAƆCƆ9Ɔ7Ɔ,Ɔ ƆAƆ2Ɔ  Ɔ!RƆ"EƆ#VƆ$:Ɔ%0Ɔ&xD$'D$‰$Ɔ)ƆEf f]u}]US$]U vftfuuKfED$$ED$ED$ ED$D$6x$(%fEUT$D$$$[]UWVS,]D$D$ D$D$6x$E$D$$$ED$}|$ ut$D$6x$E<D$<$ED$t$ |$D$6x$E>D$>$ED$|$ t$D$6x$E@D$@$ED$t$ |$D$6x$EBD$B$ED$|$ t$D$6x$EFD$F$ED$t$ |$D$6x$EHD$H$ED$|$ t$D$6x$ELD$L$ED$t$ |$D$6x$END$N$ED$|$ t$D$6x$EPD$P$ED$t$ |$D$6x$ERD$R$ED$|$ t$D$6x$ET$ED$t$ |$D$6x$EVD$V$ED$|$ t$D$6x$EZD$Z$ED$t$ |$D$6x$E\D$\$ED$|$ t$D$6x$E^D$^$ED$t$ |$D$6x$EbD$b$ED$|$ t$D$6x$EdD$d$ED$t$ |$D$6x$EjD$j$ED$|$ t$D$6x$ElD$l$ED$t$ |$D$6x$EnD$n$ED$|$ t$D$6x$E|D$|$ED$t$ |$D$6x$E~D$~$ED$|$ t$D$6x$,[^_]UWVS]ǃD$D$V$D$@D$@$D$D$F$ED$>$€Ɓ|$D$>$D$$t$D$>$D$($D$>$t+E=vD$(D$L$D$D$P$D$D$R$D$$$ǃ ǃJ D$D$$$D$D$n$D$D$$$[^_]ÐU]U]U]U]U]U]U]U]U]UE]U]U]U]U$t$]T) ;r ǃ $t$]US] u6t-D$$Lƃ8[]US] u,u#ƃD$$ؤ[]U]uu]E D$ $ۉ\$$]u]U]uu] D$$ۉ\$$]u]UUE  ED$$US]5uJD$D$$D$D$$D$D$$HD$D$$D$D$$D$D$$[]US]D$D$$ƃ(D$D$$fǃ*D$$>[]UVSu] Ɔ D$D$4$ۉ\$D$64$D$D$74$À u$=~耾 tD$D$4$Ɔ!![^]US]U yB`ÉD$$<(D$D$4$D$$*D$$>]u}]UE$US]D$$$[]UMU ‰yB`[]UVSu$=D$4$tD$D$4$[^]U]u}u] D$D$4$ۉ\$D$64$D$0D$74$4$D$34$fD$44$D$54$ ]u}]UWVS u] D$D$4$ۉ\$D$74$4$D$14$D$24$ D$34$D$44$ D$54$ ؃ [^_]U]u}u] D$D$4$ÉD$D$44$߉\$D$54$D$D$74$4$D$34$fD$44$D$54$ ]u}]UVSuD$D$4$D$D$4$\$4$ u[^]UVSu&$=~D$4$D$4$tƸ[^]U]u}u} ]D$D$4$ÉD$D$44$߉\$D$54$‰D$D$64$D$1D$74$4$]u}]US]D$$D$D$$D$$[]US]D$$%D$D$$D$$[]UWVSuE EUUEE}]D$D$4$ۉ\$D$34$‰D$D$44$ED$D$54$ED$D$64$ED$D$74$4$[^_]UWVS]u EE}t D$$uD$$D$$u@D$D$$D$$D$D$$D$D$$D$D$$ƃ(D$D$$‰D$D$5$ED$D$6$‰D$D$7$$[^_]U]u}u} ]D$D$4$ÉD$D$24$߉\$D$34$‰D$D$44$|$D$54$D$D$74$4$]u}]UWVS,u }ftzfE^VUf)؍xCfEfuKEfEUDVD$ED$E$EfEf;]uEUtBfu,[^_]UWVS,E EEEUEfUpftUEEU|BEfEljD$\$E$t,\$U$f9uEfuEE9Et 끸,[^_]U]u}}] u\$D$<$t%5uFFC F Ћ]u}]US$]D$ D$D$$D$ D$D$-$$ǃljuqD$D$$l=u D$ED$$u/2= 'D$ED$$$5u ED$D$$uZED$D$$.D$D$$0D$D$$D$D$|$D$ iD$D$$D$D$b$D$ D$D$'$$$[]US$]EED$D$$tED$ D$D$$D$ D$D$$Ѓ$[]UWVS }u ]ƃT$D$E$u܃ [^_]UVS]u $D$D$$juD$D$$tD$$>ju&D$ D$D$$tHD$D$$D$D$$D$D$$5u0D$D$$D$D$$juD$`D$ $!iD$D$H$[^]UVS]u ƃ4ƃ2$5u0D$D$$D$D$$t$6tD$$ƃ(D$ D$D$.$D$ D$D$,$D$ D$D$$5tD$D$$[^]U(]u}}] ==BE1t&=tr=f {t&C@{C \CuLJXXLCCt D$<$}D$<$S f!fPjulS Ҹ98҉T$D$<$SҸ98҉T$D$<$D$2D$<$jS Ҹ98҉T$D$<$SҸ98҉T$D$<$D$2D$<$ju5D$PD$D$ D$D$<$6D$PD$D$ iD$D$<$t \$<$Ћ]u}]UVSuD$D$4$D$4$D$D$4$D$4$D$D$7D$$0D$$<fdž*D$$>4$D$4$@u"fuD$4$Ѓ[^]US]$t $ЉЃ[]UVSÀjuD$D$($D$D$b$D$D$$D$D$$D$D$$D$D$$D$D$$D$D$$D$D$$D$D$$D$D$$D$$?D$D$$$0%D$$0D$$)=w$2ufǃ*D$$>D$$<[^]USǀTǀ D$D$$D$D$$D$$0D$$D$$D$$D$$D$$D$$juD$D$($D$D$b$ƃ(D$D$$fǃ*D$$>D$$D$D$$D$D$>$[]US]} ƃ6D$$%D$D$$$$xSD$$SL5u$$ƃ3ƃ28o2uH$$xSD$$SLƃ3ƃ28ƃ6sD$$[]UUE uD$$ D$$US]$[]U]uu EU%9yI)ȉD$D$$/:t$D$0)$1D$D$$`]u]UWVS,uU] ]M싆UЉUE䋖)9UvU}`}Y4UD$ D$D$4$)Dž̋]EU)t o뢃,[^_]U]u}uE %9y^)Љ0~0<|$D$E$/E0)D$D$E$D$`D$E$4UD$ T$D$04$U9r 9v"D$`4D$U$Ӂ%9yi)؉0~0?0D$4T$$/J0)D$40D$$D$`4D$$]u}]US]$0uTO$T%9x % ;s % ȉT[]UE$U]uu] 4$+yk}]u]UE$US]ju5u $$$(t$ǃ[]UWVS,}U ƇhƇfLJrfz$ fz8 B,  B<BLBlB\%ƇLJLJ0LJ`LJ@LJk`$LJfLJ*Ƈ2Ƈ3Ƈ68 $ Ɖ$t u<$ <$(u<$<$u<$a$8LJLJLJLJLJLJLJLJLJGDGHGLGhG8LJLJ<Ƈ5$8LJLJLJLJLJLJLJLJLJGDGHGLGhG8LJLJ<Ƈ5$8D$D$<$D$D$<$D$<$ED$ D$D$<$ D$<$ u ƇLJLJLJLJLJLJLJLJLJGDGHGLGhG8LJLJ<Ƈ5EEED$ D$&D$<$D$<$D$5<$<u3D$4<$yEEEEE uEƒ+EƇLJLJLJLJLJLJLJLJLJGDGHGLGhG8LJLJ<D5E)؃ƇLJLJLJLJLJLJLJLJLJGDGHGLGhG8LJLJ<Ƈ5P}ƇLJLJLJLJLJLJLJLJLJGDGHGLGhG8LJLJ<Ƈ5ƇLJLJLJLJLJLJLJLJLJGDGHGLGhG8LJLJ<D5}u$<$-<$D$8$j<;Ƈi5LJLJLJLJLJLJLJLJLJGDGHGLGhG8LJLJ<LJLJLJLJLJLJLJLJLJGDGHGLGhG8LJLJ<fLJr<$u<$fLJrfLJrLJLJLjuY5uPD$pD$D$ D$ 7D$0$ufLJp ,[^_]US]$2uH$$xSD$$SLƃ3ƃ28D$$[]U]uu2juD$:4$D$4$Äu < uDP u0<u8Ɔ< ?Ɔ< 1<$Ɔ<8<]u]USd]8$tZuQi9rD2u;5D$$ƃ3ƃ2c2uZ=t 3uH$=$xSD$$SLƃ3ƃ28=tA8-t"uEjED$$d[]ÐU]U]U]U]U]U]U]UU EH]U]U]UE 8u E@h]U]U]US].D$D$$0D$D$$D$ D$D$$[]UWVSDwD$ED$E$u fuǀ}uE$EXE}JD$ D$D$E$D$AD$=E$D$D$E$D$ D$D$'E$<[^_]US]E} tuy=D$pD$ $D$ D$D$'$D$0D$ $D$ D$D$'$rD$@D$ $D$ D$D$'$8D$D$ $D$ D$D$'$[]US]5uDHt'fǃ.H<f;f0&fǃ. fǃ0>fǃ.fǃ0>.D$D$$0D$D$$[]US]$t+$tD$D$ ($[]US]D$ D$D$$7D$ D$.D$$07D$ D$0\$$=7[]US]D$$`t @u2Ѓ[]US$]U $Ppf.‰D$D$$0D$D$$D$ D$D$$ff0.D$D$$0D$D$$D$ D$D$$‰D$$fED$ ED$E D$$J7f,fU‰D$,D$$D$ ED$,D$$/y‰D$$ED$ ED$E D$$e7CEUD$‰D$$D$ ED$ED$$0$[]UE} tD$D$$D$D$$US].D$D$$0D$D$$D$ D$D$$} u!ChD$D$$*ChD$D$$8[]Uh]u}u} u EEEE2E$4$tIغ\D$D$@4$غXD$D$A4$GXغ\D$D$@4$غXD$D$A4$5u:D$D$4$D$D$4$dž5t ]u}]US$]ǃ`D$`D$D$ D$7D$7$$t=$ǃ7ǃ$ǃǃЃ$[]ÐU]U]U]U]U]UU EH]U]U]UE 8u E@h]U]U]US]5uDHt'fǃ.H<f;f0&fǃ. fǃ0>fǃ.fǃ0k.D$D$$0D$D$$[]US]E} tuy=D$pD$$D$ D$D$'$D$0D$$D$ D$D$'$rD$@D$$D$ D$D$'$8D$D$$D$ D$D$'$[]US]0D$D$$D$ iD$D$$[]US]0 D$D$$D$ iD$D$$[]US]D$ D$D$$7D$ D$.D$$7D$ D$0\$$7[]US]D$$`t @u2Ѓ[]US$]U $ppf.‰D$D$$0D$D$$D$ iD$D$$if0.D$D$$0D$D$$D$ iD$D$$‰D$$fED$ ED$E D$$7f,fU‰D$,D$$D$ ED$,D$$@0y‰D$$ED$ ED$E D$$7CEUD$‰D$$D$ ED$ED$$`0$[]UE} tD$D$$D$D$$US].D$D$$0D$D$$D$ iD$D$$} u!ChD$D$$*ChD$D$$8[]Uh]u}u} u EEEE2E$4$tIغ\D$D$4$غXD$D$ 4$GXغ\D$D$4$غXD$D$ 4$D$D$ 4$5u:D$D$4$D$D$4$dž5t ]u}]US$]ǃ`D$`D$D$ D$8D$$8$$t5ǃ=8ǃ$ǃǃЃ$[]ÐU]U]U]U]U]U]U]U]U]UU EH]UE 8u E@h]UE} tD$D$$D$D$$US]$$D$D$$D$D$$D$ D$$D$D$$D$@D$$D$ D$D$$D$2$D$ @D$D$$D$$$[]US]$$tMD$D$ ($$ǃE8ǃǃǃЃ[]US]E} tuy=D$pD$ $D$ D$D$'$D$0D$ $D$ D$D$'$rD$@D$ $D$ D$D$'$8D$D$ $D$ D$D$'$[]US]fUE  ҉T$D$$D$ *D$D$$D$$[]US]E  D$D$$D$ *D$D$$D$$D$$[]US$]M  $pED$$ED$ED$ ED$D$L8x$@ՉUfED$T$$D$ ED$ED$$0D$$fED$ ED$E D$$c8f,fMD$,D$$D$ ED$,D$$0kD$$ED$ ED$E D$$~82EMD$D$$D$ ED$ED$$0D$D$$D$D$$D$ D$$D$D$$D$ D$D$$hD$@D$$D$ D$D$$D$2$D$ @D$D$$$[]UD$ E$pUVS0uD$D$ D$D$8x$]\$4$ED$ED$ ED$D$8x$u0[^]U]u]} ChD$ 1D$D$$D$$D$$@D$D$$%D$D$$2ChD$ =D$D$$8]u]UWVS\u} u EEEE2E$Xغ\D$D$@4$غXD$D$A4$Hȃ؃ t@ʃttuv vtD$D$4$D$4$狖Httu t&D$D$4$D$4$ƒу H%=uу8D$D$4$\[^_]ÐU]U]U]U]U]U]US] uD$$ƃ[]U]U]U]U]UE]U]U]U]U$t$]) ;r ǃ $t$]UMt E D$ $U]U]uu EU%9yI)ȉD$D$$/:t$D$0)$1D$D$$`]u]UWVS,uU] ]M싆UЉUE䋖)9UvU}`}Y4UD$ D$D$4$)Dž̋]EU)t o뢃,[^_]US$>@<tD$$<tD$$<tD$$<tD$$<tD$$<D$$<ED$$>ȃ[]USǀǀ $0%D$$0$2uD$$.D$$&D$$>D$$,D$$$D$$.D$$&D$$(D$$ $0f `D$$0fǃD$$>[]UEUS]D$$0D$$<fǃD$$>D$$5D$r$5D$ $D$v$5D$w$5D$$7[]UVSD$$0D$$(D$$ $0%D$$0D$4$)=w$2ufdžD$$>D$$<[^]U]u}u} u"4$D$4$oD$4$0D$D$4$D$D$4$|$4$D$$5]u}]UUE uD$$ D$$US]$ []US] u,u#ƃD$$ؤ[]U]u}uE %9yT)Љ<|$D$E$/E0)D$D$E$D$`D$E$4UD$ T$D$04$U9r 9v"D$`4D$U$Ӂ%9y_)؉?0D$4T$$/J0)D$40D$$D$`4D$$]u}]US]$0@uO$(%9x % ;s % ȉ[]UE$U]uu] 4$+yk}]u]UE$US]D$$5D$$<D$$>$([]U]u}u] Ɔ$ 8f{$ff{8[C( C<CLClC\%Ɔdždž0dž`dždž0k`$džfdžuB $ lj$t u4$a 4$(u4$4$u4$dždždždždždždždždždždžFDFHdžFLF,FhF8dž<4$u4$*džD$"$7]u}]U]uu]E D$ $ۉ\$ $]u]US]E D$ $ $[]ÐU]UED$D$$UEƀPƀPƀ ƀSƀ-ƀRƀeƀvƀ :ƀ!1ƀ" ƀ# ƀ$Lƀ%-ƀ&Rƀ'eƀ(vƀ):ƀ* ƀ+]UED$D$$fUVS]u t>tD$D$$WD$D$$<tD$D$$D$D$$ft%t;uXD$D$$=D$D$$"D$D$$fxS uUD$D$$tD$D$$D$D$$xS~uUD$D$$tD$D$$D$D$$D$$[^]U]U]US]D$D$$SfS D$D$$SD$D$$fSD$D$$[]UWVSÃ?UfED$$ED$D$$D$$D$$u)=vfE%?9Et f} zƒ[^_]US]ǃǃD$$D$.D$ $D$$D$D$$D$D$ $D$D$$D$D$$D$D$$D$D$$D$D$$D$AD$$D$D$ $D$D$$D$'D$ $D$D$ $ƃ ǃ $[]UME wD$T$ $4v D$$UWVS,uD$D$ D$D$8x$8]\$4$ED$ED$ ED$D$8x$ u5]$ED$ED$ ED$|$x$@uD$D$ D$D$8x$,[^_]U} tD$D$ $D$D$ $UWVS }t D$<$D$ D$<$D$ D$<$D$D$<$$P؉ѺD$D$<$֋$P؉ѺD$D$<$ց} u4$H@D$D$<$D$D$ <$<vD$PD$<$D$TD$<$$UD$<$:<t<t<uƇ*1Ƈ*2Ƈ*3ƀ  [^_]US]} D$D$ $D$D$$D$2$D$D$ $D$D$$D$$D$D$$D$7D$$D$'D$ $*$D$$xSD$$[]UWVSfUD$D$ 4$D$4$D$'D$ 4$D$/D$4$D$4$D$D$4$D$D$4$D$D$4$D$4$D$4$u)=D$4$f ǃu׉xv;D$4$f%?  D$D$4$2D$D$4$D$D$4$D$4$D$D$4$D$D$4$D$D$4$f}txSD$4$D$ 4$dž [^_]U8]u}u] == BfS=t~=ff=ftf=Fh Fh{CSC SCS4$wC[t D$D$ D$D$8x$E}D$4$%?D$D$4$D$4$u)=vD$4$?fUf%fED$ED$ ED$D$8x$ft ftfu.D$D$ D$D$8x$E}D$4$%?D$D$4$D$4$u)=vD$4$?fUf%fED$ED$ ED$D$8x$ZuUt fS C?f ҉T$D$4$ff]u}]US]t RfD$D$$[]US]D$$t&t   []UWVS\}Gh} wt É<$u)= v倿vD$PD$<$D$TD$<$f=uD$D$<$Gh$(f tRf=uHwfff ufvErED$<$.D$<$D$D$<$f=uD$D$<$?D$<$%D$D$<$ff\[^_]Ux]u}]f=D$D$$D$$D$$=ff fD$$ƃfCh w uUED$$D$D$$D$$tD$$?tf v҃ ֋E+=v=E+=w7t9tf5 E+=vWt9tf5E+=v&f;vErED$$]u}]ÐUEǀ]U]U]U]U]U]U]U]U]U]US]tD$$ƃ[]U]U]U]U]UE]U]U]U]U]UE$U ]uu] 4$+yk}]u]UMt E D$ $U8]u}]u }|$D$ 0D$D$$x4f#E fE|$D$ 0D$D$$]u}]UE fEED$D$ 0D$D$$U(ED$D$ 0D$D$$xUU(ED$D$ E D$D$$ xUUD$ED$ E D$D$$ UWVSuUtY] ]׉E)9vӉ\$D$ $غ)lju[^_]U]u}ljօÀ=u tt t$<$]u}]U]u}} D$`|$]$4t$ \$D$0E$D$`t$E$|$E$]u}]UEǀ T$$UD$ $UVS0]u ED$D$ D$D$$xLu$2t$D$$$R0[^]US]ǃ$$(t&$ǃǃǃ$[]UWVS,ufEƆdždžED$D$ D$0D$$-fe]\$D$ D$0D$$fE\$D$ D$4D$$D$4$fdždždždždždždždždžFDFHdžFLF,FhF8dž<dždždždždždždždždžFDFHdžFLF,FhF8dž<=u dž<Ɔdždž0dž`dž dž %k`$dž $ lj$t u4$       dž(ED$D$ D$D$$4$D$4$u dž F8Ѓ,[^_]US]u#D$$ƃؤ[]UWVS u} E$f)؃w4$9uE$4$9 [^_]ÐU҉T$D$$UEƀUƀ2ƀ ƀSƀ-ƀRƀeƀvƀ :ƀ!2ƀ" ƀ# ƀ$Lƀ%-ƀ&Rƀ'eƀ(vƀ):ƀ* ƀ+]U]UEUEU]U]U]US]f D$D$$D$D$$fD$D$$[]UVS0]D$D$ D$D$0x$D$D$H$D$D$ D$D$8x$fEll9D$$fED$ED$ ED$D$9x$EfEf=vfED$D$ ED$D$9x$ED$D$H$fEE ЉED$$ED$ED$ ED$t$x$UfUfvEfEf>D$D$ D$D$9x$D$D$H$0[^]U8]u}M j`jB0=t^=fs$fE@hWyMA UAA$"AY"9D$D$ D$|$Ux$%?D$D$E$D$E$D$U$?fUf%fED$ED$ ED$D$%9Ux$ft ftfu-D$D$ D$|$Ux$%?D$D$E$D$E$D$U$?fUf%fED$ED$ ED$D$.9Ux$^uYQ?A ̀ ‹E=yu7A/t//v,u=t&t^u f]u}]U(]u}É։кt`%?EED$D$$D$$D$$Ѓ%?9tf v‹]u}]UVS]u t(tf2f"t ftt!u1#fxS u.itU GxS~u.2t D$$D$$[^]Uh]u}}= $ u,0Ëp+(=v<+,=w7t9tf5,0 ,+,=vht 9tf5 0+0=v8f; v(ErED$<$ff ]u}]US]U u‰D$D$$uaD$T$ D$D$$D$D$ D$D$99x$1D$T$ D$D$$[]UVS0]ut$D$ D$0D$$fet$D$ D$0D$$ffEt$D$ D$DD$$D$D$ D$D$$ D$D$ D$D$$ D$D$ D$D$$ ffEED$D$ D$DD$$D$D$ D$D$$ D$D$ D$D$$ D$D$ D$D$$ ffEED$D$ D$DD$$D$D$ D$D$$ D$D$ D$D$$ D$D$ D$D$$ 0[^]US]$D$D$$D$d$[]UWVS,uED$D$ D$0D$$Afe]\$D$ D$0D$$fE\$D$ D$4D$$\$D$ D$<D$$fE\$D$ D$<D$$dž% dž- D$D$4$D$D$H4$D$D$4$D$D$4$D$D$4$D$D$4$D$D$4$D$AD$4$D$D$H4$D$D$4$D$D$4$\$D$ D$<D$$fE\$D$ D$<D$$D$4$fE\$D$ D$<D$$D$4$D$/D$4$D$4$D$D$4$D$D$4$D$D$4$D$4$D$4$u)=ED$4$f tEwcvEx w;D$4$f%?  D$D$4$2D$D$4$D$D$4$D$D$4$$4$Ɔ Ѓ,[^_]UWVS }E -!D$<$?<vP T $P؉ѺD$D$<$֋$P؉ѺD$D$<$ց} u4$H@D$D$<$D$D$<$$UD$<$<t<t<uƇ*1Ƈ*2Ƈ*3ƀ  [^_]UVS0ufE} &D$D$4$]\$D$ D$D$$fM\$D$ D$D$$D$24$\$D$ D$D$$fe\$D$ D$D$$D$D$4$D$D$4$D$D$4$]\$D$ D$0D$$fe\$D$ D$0D$$4$D$4$4$D$4$xSD$4$0[^]UVS0u} ]\$D$ D$D$$fMD$D$4$\$D$ D$D$$D$,4$\$D$ D$D$$fe\$D$ D$D$$$D$D$4$A4$D$d4$4$D$4$D$4$0[^]UVS0] cCh} Ɖ$u)= v$(f$f=u ChD$D$$D$$f=u oD$D$ $D$D$$D$$f"=t9EEED$D$ pD$ D$$D$D$ $0[^]ÐU]U]U]U]U]U]U]U]U]U]U]U]US]f D$D$$D$D$$fD$D$$[]UMU =t0=Bt8jX=t=fupAhgf4\BSzuMB BB $(zu"B=t ^t,u US$] } t}D$D$$=t9EEED$D$ pD$ D$$=u2$$D$D$$$[]UVS uD$D$ D$0D$$f%D$D$ D$0D$$fD$D$ D$4D$$D$D$4$D$4$D$D$4$D$D$4$D$pD$4$D$/D$4$D$B"D$4$D$D$H4$D$D$4$D$D$4$D$D$4$D$D$4$D$D$4$D$D$H4$D$D$4$D$|D$4$D$D$4$D$D$4$D$=D$4$D$D$4$D$4$u)=vD$D$4$D$D$4$D$4$u)=vD$D$4$D$D$4$D$D$H4$D$AD$4$D$D$H4$D$D$4$D$D$4$džB džB Ѓ [^]UE ffE$UWVS,uD$D$H4$p]\$4$ED$ED$ ED$D$C9x$u|$D$H4$]\$4$ED$ED$ ED$D$C9x$uuD$D$H4$,[^_]ÐU]U]U]U]U]U]UU EH]U]U]U]US]D$|D$$D$*D$$D$"D$$[]US]D$ D$D$$D$ D$D$-$D$ D$$D$ D$$D$D$$D$D$$D$D$$D$6D$$D$"D$$[]UD$ D$D$E$US]D$ D$D$$D$d$D$D$$D$ D$D$$D$AD$=$D$D$$D$ D$D$'$[]UUE 8u(BhHtD$)#D$$UWVS,EEEE|fEGft?ؾDD$ED$E$uvuɃE}u,[^_]UWVSLD$ D$D$E$D$ D$D$-E$EEEEEEEEEEEE|fEGft1ؾDD$ED$E$u׃E} dD$ D$D$E$D$ D$D$E$D$ D$D$-E$D$AD$=E$D$D$E$D$ D$D$'E$L[^_]US]$$[]US]E} t u{f=D$D$ $D$ D$D$'$D$0D$ $D$ D$D$'$rD$PD$ $D$ D$D$'$8D$D$ $D$ D$D$'$[]US]D$D$k$D$D$ $[]UWVS}D$ D$D$<$D$4<$D$5<$uD$D$<$ uD$D$<$D$<$t\$<$\$<$ \$<$t봃[^_]US] } |3ChD$(BD$`$D$(BD$k$Hu:Lu.>f-D$D$$L!><D$D$$D$D$$D$D$$D$?D$$D$*5D$$D$0D$$D$<D$$D$?D$$D$KD$$D$D$$D$ D$D$$D$D$$QChD$ ND$D$$$D$D$$L[]US]$$ǃL9ǃǃDfǃ>ǃǃD$$[]US]=|3u5D$$fu D$ D$D$$=|3~+D$$fv |3 |3K=|3~BD$D$$D$ D$D$$|3[]US]HtD$`D$$LtHu$uD$$u2Ѓ[]UVS uU c$p‰D$4$fED$ ED$E D$$T9"f,fU‰D$,D$4$D$ ED$,D$$ 1‰D$4$ED$ ED$E D$$o9EUD$‰D$4$D$ ED$ED$$,1PUEPUD$4$ED$ ED$ED$$P1u [^]UWVS\u} u EEEE2E$غ\D$D$@4$غXD$D$A4$HD$VD$4$D$D$4$D$D$4$D$D$4$D$^>D$4$D$D$4$D$D$4$SxSuD$D$4$D$D$4$D$ D$4$D$D$4$Ht2D$`D$4$D$sMD$4$D$`D$4$ tuH\[^_]ÐU]U]U]U]U]U]U]U]UuD$ D$$D$D$$UVSƻغ\D$D$4$غXD$D$ 4$HD$VD$4$D$D$4$D$D$4$D$D$4$D$^>D$4$D$D$4$D$D$4$vxS=tfu2D$PD$4$D$D$4$0D$D$4$D$ D$4$7Ht2D$`D$4$D$sMD$4$D$`D$4$[^]UEU HUVS uU c$p‰D$4$fED$ ED$E D$$9"f,fU‰D$,D$4$D$ ED$,D$$p1‰D$4$ED$ ED$E D$$9EUD$‰D$4$D$ ED$ED$$1PUEPUD$4$ED$ ED$ED$$1u [^]US]=3u8D$;$fu#D$ iD$D$$=3~+D$;$fv 3 3N=3~ED$D$A$D$ iD$D$$3[]US]E} tuy=D$D$$D$ D$D$'$D$0D$$D$ D$D$'$rD$PD$$D$ D$D$'$8D$D$$D$ D$D$'$[]UUD$ iD$D$$US8o<:+<;3#l9D$D$>$D$D$C$D$D$D$D$D$$D$ <D$D$$D$D$o$D$=$fuUD$ =D$D$$D$D$o$D$D$$78<=8u0D$=$ft(=8u+<=,w =8D$=$furD$@$f>8Bft(Luf)D$D$9$Gf@D$D$9$'D$ =D$D$$8D$D$o$D$D$$8[]US]bHtD$`D$$LtHu$2[]USd] .} fpt`D$#D$$D$D$ $D$0D$!$D$D$"$lD$9D$5$D$$%D$D$$D$ D$D$$D$$D$$tErED$$3ChBft/Lu#>f)D$D$9$%@f>D$D$9$D$D$$D$D$$D$?D$$D$*5D$$D$0D$$D$<D$$D$?D$$D$KD$$D$D$A$D$ iD$D$$D$D$$w=8v8/ChD$ iD$D$$$D$D$$Ld[]UST]E =u.EEEE2E$\ u"H%H5=u"H%H T[]US$]=8u8D$>D$D$ D$9D$0$D$pD$D$ D$9D$0$$[]US$]$ǃ9ǃǃǃ8D$>D$D$ D$9D$0$ufǃ>8f>ufǃ>8D$$Ѓ$[]US] ==Btp=f'=t=v=8t&u E@hUHD$)#D$$=8uCCt tt!03 38<{urEfpfUfpT=8uK83<.{uCUf@C fB{u SE[]ÐU]U]U]U]U]U ]U]U] _ ıR j<, ]"""E"""""""""""""""""""W"</""""""""""""b""""""""""!"" !""""""""""""""""""""""""""""""""""]""""""""!##)#)#)#)&''#)#)#)##)L##)#)#)#)#)#)&&#)((#)#)#)##)#)#)#)#)>$#)#)#)#)#)#)#)#)#)#)#)#)#)$5''#)##)#)#)#)#)#)#)#)#)u((#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)(#)#)#)#)%$#)#)#)#)#)#)#)#)#)#)#)#)#)(#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)#)(#))BCDEFGHIJD9^ Te|Lr(\7L 04":t(1/M#JyCsk-> * *>-ksCyJM#/1(t:"40 L7\(rL|eT^ 9D; Ql;#_y^9 >^opw4&6nPj\geC?+15XJVeO*####*OeVJX5+1?Ceg\jPn&64wpo^> 9^y_#l;Q ;ESA|:!h@y U5Q2\$^+dd+^$\2QU5 y@h!|:ASE9k{$b1MAF] SbH-l O)!%!%)O lH-bS ]FAM1b${k9b/ ~]԰(2<GQv[ enx2dp@5!Cs/Q pa@ YB< &R@.UY6 X>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?dx S{1ILLI1{S xd  1 4Zr A1S>K>KS1A r Z41  (n-b$#..#b$-n(~b w 4)7[D[D7)4 wb ~, U]ed;d;e]U,   `ZX :CeHeHC:X Z`  UH ^ (//(۸^  HUk[R OvRZ~ +!?!?+ ~ZRvOR [kF qG%X I>F>FI X%Gq FA0!/"QL}MDDM}LQ"/!0APd4ol% % lo4dPJ_V68<T#WNW bb WNW#>gjXp>Y&&Y>pXjgf&&3%A! A!%2&( |w .Bܒ"?AA?=;4 -C$ #X)^Ao1sj  =Uq~ iz!* 39>AB@;5.d%7 y'BoOP  OAT )29C>YABu@<6/&^8 j_{f8)4y  ]t7 {(1F8=A#B@&=w7"0'Y %.l?)l  l)?l.% Y'"0w7&=@#BA=F81({ 7t]  y4)8f{_j 8^&/692) TAO  POoB'y 7d%.5;@BA>9 3*!zi ~qU=  js1oA^)X# C$ -4=;?AA>?:3+#LY=^O4\. .\4O^=YL#+3:>?AA?=;4 -C$ #X)^Ao1sj mfffffffffffffffffffffffffff3Y.'"!љ SHGم9E\.Y !"4W5͋o֬'8jItw )YQi f coY;t;tYco f iQ)Yw tIj8'@m7@m7@m7@m7@ m7m7 @ m7m7 ///000+0 ;; ;;$;0;<;RRR R,R8RDRZZ[1[r[[[5\v\\\                 1-*(!&$3/64#9=  :8%" ;?><')5  20+7 .,., 5)20  7+%>< =9" ':8 ?;!64-1&$#*(/3xwknpxei^TYYn`}v`WOJ8?GRPgsp]IF85160=AN\u~dOC.('" /+BHc{aQB(%$-EVd|oS>, +;Nh{qZD1! &4I]voZ<7#  0;WjhU92 !5>Xmt_K6$ #3FXsyjL9) ., +;Nh{ҤqZD1! &4I]v֬oZ<7#  0;WjѩhU92 !5>Xm׫t_K6$ #3FXsڰyjL9) .f9c:=^<>FFIDGIHEHFFIEFICGJGFHEGIRURUQTQTSUSVRURUƑ^aő^aȝ]`ȝ]`ĕ_bđ_bƝ^aƝ^acjmbkmfileilakm`kncjmbjmFvyFvyHuxHuxDwzDwzFvyFvy㒂㒂极极ᒃ㢂㞂ƒƒĒĒh%'h*,h%'h*,ʹ*.Ř.1ʹ*.Ř.1̴+.Ŝ/1̴+.Ŝ/1s58l7:s58l7:p68i8:p68i8:QACNBDU?BR@CR@COBDR@COBDJMKMJLJMLNLOJMKNڑUXٍVXޡTWݝTWؑVYבVYۡUXڝUXÑ`b‘`bŝ^aŝ_a‘`cacġ_bá_bcjmbkmfileilakm`kndjmbjmIuwIuwLsvKtvHuxGuxJtwIuw~~ꖀꖀώώҢҢΖΖѢТh%'h*,h%'h*,ΰ*-Ƙ.1ΰ*-Ƙ.1ʹ+.Ř.1ʹ+.Ř.1u47m69u47m69r58k7:r58k7:U?BRACW>AT@BQACNBDU?BR@CAIK@ILAHK@ILJLJMILJMߕSVޕTVRUSVܑUWۑUXߡSVޡTWƑ^aő^aȝ]`ȝ]`ŕ_aĕ_bǡ^aƝ^ahhkhhklgjkgjgikeilihkhhkMsuMsuPqtOruLsvLsvNruNru}}||}}|}ԎԎآآЊЊ֞֞Ӡ(+Ɉ,/Ӡ(+Ɉ,/Ь),ǔ-0Ь),ǔ-0q58j7:q58j7:k7:e9[=@_;>[=@\@]@FFIDGIHEHFFIFFIDGJGEHEFIORPRNQORPSQSORPRБZ\ύZ\ӡX[ҝX[ϕZ\ϕZ\ѥY\ѡY\ycfycfbd~betegseg{be{ce\lo[mo`kn_ln[mpZmp^lo]loFvyFvyHuxHuxEwyDwyGvyFvy~蒁璁ВВӢӢϖϖҦѢh%'h*,h%'h*,Ռ')|+.Ռ')|+.|25s57|25s57x36p68x36p68c:<_;>f9d:<_;>KDFIEGNBELCFLCFJDGLCFJDGMOMPKNLNMPMPLNLOڑUXٍVXޡTWݝTWؑVXؑVYܡUW۝UXƑ^aő^aȝ]`ȝ]`ŕ_aĕ_aǡ^`Ɲ^algjkgjpfiofikgjjhjngimgiPqtPrtVorUorQqsQqtTprTps@y|z|Bx{Bx{z|z}Ay{Ay|㒂㒂极极▃ᖃ䢂䢂̒̒ϢϢ˖˖͢͢h%'h*,h%'h*,h%'h*,h%'h*,ø/3|25ø/3|2503y3603y36l7:f9;l7:f9;i8:d:KGEL:αOO9MEGK?ͶO)ЇP4NCIJA̻N1ϠP/N@JHC˿M6ϪP $O=LFEL;βO!P8MDGK@ͷO+АP3NBIIB̼N3ϢP,O@KGDM7ϭP"O;LFFL<γO$P7MDHJ@͸O.ЖP2NAIIB̽N4ϥP)O?KGDM9ίPO:LEFK=δO&P5MCHJA̹N0ϛG(F9BA<öE/ƢG!F5C@>¹D3ƩFF2D>@C6ŰF#DžG.E;BB9ijE*ƙG'F8CA<÷E0ƤG F5D@?ºD4ūFF1E=AC7űF$njG,E:BB:ĴE,ƝG%F7CA=÷E1ƥFF4D?@ºD4ŬF G0E=AC8ıF&ƒG*E9BB;ĵE-ƠG#F6C@>øD2ƧFF3D?@C5ŮF!G0E[OWVP[Aܰ]4\KXURZEܹ]%]GZSTYJ\1]B[QVWN\;ݡV4UGQPJT;լV+UCROLSAԵUU@SLORDԼU-քV:TIQQGT6աV3UFRPJT=կU'UCSNMSBԷU#U?SKPREԾU0ՌV8THQQHT7դV1UERPKT>ձU#UBSMNSBԸU& U=TJPRFӿU2ՓV6TGQQIT9ըV.UDROLS@ճU UASMNRCԺU*V;TJPQFU4՚O-M@IGBʼL3ΣO#N̵N'ψO1MAHHA˺M0ΝO(N>JFCɾL5ΩO N9KEEK:ͱN O5LCGI?̶N*ύO0M@HHA˻M2ΡO%N=JFCɿL7ͫNN8KDEJ;ͲN"O3LBGI@˷M,ΓF$E7A@:´D+ŜFE3B?=C2ħE E/D;@B5ĮE ņF(D8AA8òD(ŔF!E5B@;µD/šEE2C=>C2ĨEF-D:@B6ïE"ʼnF&D7AA9óD)ŘFE4B?<¶C0ţE E1C=>B3ĪEF,D:@A6ðE$ō57)d>(::(>d)75ˬܬ 1BSdw̭ݭ%qBP ivz~vx|~vx{~vw{~vwz}vvy|~   %]   -  (,(  -S "7R2p #4DPUPD4#  -s -~O҂b'f #8Ph}}hP8#  - 0YvVRSO  #8TttT8#  - 1]ƥ +F; _ m4]"( #8Tx;PXP;xT8#  - #>2^"B2ۦ 3 GB 3)3D?7L4Zh$Fx  #8TxDwwDxT8#  - #F2^%j ro 8&/2@IQ@eX|dβ,k<6  #8Tx\PyyP\xT8#  - #F2^&S ϷsD{*=E8YIQ_pyph$~H~l%ME912  #8TxhX$Rp{pR$XhxT8#  - #F2^6'zk # M Yu,&<)Ph8f JP'9m9{y S  #8Txl =$WxxW$= lxT8#  - #F2^>' "vw) Xx!->Se%oX+ +t ,Md9Q3+om7VI .|E ]G M   #8Txl,yR TT Ry,lxT8#  - #F2^>'y3 oqkS!.?MWVs,Elz3@(g0dfО J9Sf~$ l z D O>pRzb*Rii   #8Txl0 $$h*h$$ 0lxT8#  - #F2^>'{7 {+!1/@ͼWgu' IN@Cr&~ߎub| = ? ` jK:*\RX"Kge!|$Cv'x*   #8Txl0,Lx TT xL,0lxT8#  - #F2^>'B{8 {!D/Y AX%vl !޴%)w-I2R6Yw;9@EY"I   #8Txl00d _H\ , s s , \ H_ d00lxT8#  - #F2^>'J{8 ;!]/UA%X=wL<][E4t,n;-=OJ5( [U JjLzj~.B"64;' ,w91H63v<;B.IO}dVկ ^(eehl~tHz(|   #8Txl00p"\ 8 d D D d 8 \"p00lxT8#  - #F2^>'J{8 ߀[!g/nA&Y}xH\a=4^TY+XMe^ o] kɁ sRN1(f2IV}!>&,+&ݗ1j7>Ek MU$^gq䉣{   #8Txl00t.pH  l  4$6$4  l  H p.t00lxT8#  - #F2^>'J{8 !k/ yA?Y7xD!|x)deCpnv7I  O s!^.m#Xn7$) /I6,=~ENmWsa^/l5wbF&4"X 99X "4&Fb J@L%X@m7@m7@m7@m7@m7@m7@m7@m7@m7@m7@m7@m7@m7@m7@m7@m7@m7@m7@m7@@@@@@@@@@@@@@@@@@@@@@@@@@@@@9̞%"<9b@9̞%"<9b@9̞%"<9b@9̞%"<9b@9̞%"<9b@9̞%"<9b@9̞%"<9b@9̞%"<9b@9̞%"<9b@9̞%"<9b@9̞%"<9b@@W'e>' 2W;@W'e>' 2W;@W'e>' 2W;@W'e>' 2W;@W'e>' 2W;@W'e>' 2W;@W'e>' 2W;@W'e>' 2W;6<_  ,6e!Bd!;h 3m"-m#%m#n#>f$9h&4j&-m)*k #Ad #;g $6i $/k $)l %#m %=e '9g (5h *0i +,i 3o ,r %t u v  v /q *r %s t t  7i 2l -o 'p  r r  3k !/l "+m #'n $"o  4l .p 's u v w  0n  +p  &q  !r  s -q &t  w  y  { |  (r $t u v wOWN9!+GvU}0G7%%G70}UvG+!9WNO-S WS - #8(TT`~ # ^zR_53K S5|?' '~* ]) $G&Co.#   #.oC&G$ ])* ~' '?|5 SK35_Rz^\kdk\w172] |X%GD\QwDu @A[ /8/N#}Y%K'koW^jYT+Gnb&1NRZQ_ JdA<2M_ 4O`cl%I 0Vy)"CEL& .<Fv^W[ @E YZ</kjG; 2 U\4 06_ BN%Wa1 q  1>, 5wC$/n &rksW! ]77] W!skr& n/$Cw5 ,>1 q a1W%NB _60 4\U2 ;Gjk/<ZYE @ [W^vF<.& LCE")yV0 I%lc`O4_ M2<AdJ _ZQRN1&bnG+TYj^oWk'K%Y}#N/8/ [A@ uDwQ\DG%X| ]271wiRLi# ^#iLRi(+ L\^L\0!YRl^j'F2?*V S V>M ZQk A(ZB xJ u:%TYCC 3#T; oY[I]2 -5{\U)Y  Og8A? ? A8gO  YU)\{5- ]2I[Yo ;T#3 CCYT%:u Jx BZ(Ak QZ M>VS *V?2F'j^lRY!0\L^L\ +(L B]?]?]B L._gU *J8GJ 7ivR_}9 C@xTFv%%vFTx@C 9}_Rvi7 GJ8J* Ug_.q.)Y).# OP7<b_|Esr9s^PIEKTf~TXtYC4-+2<Mb:wA_D/!'7On"]v5rR5" )@`Sn-kJ. #:W{ Il)iF, 6Sy Fp1mL3%>\}O}=xV=(0Gd[NhN9*$ &1AZu.gd'cQB;8?H[pBEoaXU]ev*ak8|z Q`4 !Gzf?+R{uV;# /Cbx_UKHP\i_ٶٶ?Sʷ (08@HPX`hpx$4DTdt ,Ll ,Ll\\\\<< < < < < <<| |"|$|&|(|*|,|.|0|2|4|6|8|:|<|>|A|E|I|M|Q|U|Y|]|a|e|i|m|q|u|y|}(8HXhx(8HXhx0Pp0Pp ` ` ` `@@ @ @ @ @ @@!#%')+-/13579;=?BFJNRVZ^bfjnrvz~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !!"##$%&&'()+,./011234456679:<=?@@ABCCDEEFGIJKMNPPQRRSTUUVWXZ[]^_`abbcddefghjkmnopqrrsttuv  !!"#$%&'()*+,-./00123456789:;<=>?@ABCDEFGHIJKLMNOPPQRSTUVWXYZ[\]^_`abcdefghijklmno-@  &01sGGsG@sq ?*@ 92A-b(# 02469<-0247:=@onmlkjihg f e d c ba`_^]\[ZYXWVUTSRQP O!N"M#L$K%J&I'H(G)F*E+D,C-B.A/@0?1>2=3<4;5:69784;5:697@SRQPONML?o/_^.n>=m-] \,l<;k+[K JZ*j:9i)YI HX(h8p7g'WGFV&f60u5e%UEDT$d4ts3c#CB"b2rq1a!A@ `vwonmlkjihgfedcba`_^]\[ZYXWVUTS@@@ @@@  $).3:@HQ[;741.L,)|'H%0#8!\d4< | $ )+J""":Wt"""[l]rnr qq;qLrTsTsTsqrrrrrrrsTsTsTs|qq:sLq]qrt%uauu&v&v&vPuZZjVjVb$Fb$FKc B:Sy P  f y  :FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF::FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF$8L`t(<02FFFFFFFF+ !0Do"/992:W::::;w=~<~<;;'OTOOpPLPjRRRfS"TSeTSTm&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&֯@ @` 0@P`p (08@HPX`hpx  $(,048<@DHLPTX\`dhlptx|   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~);`z  B,AsuG kk1kkkkkkkkkkkkkkkkkkkWWkkkkkkkkDkkkkkkkkkkkkkkkkkkk]Q*zBO1 V*CKAF\@y#~82I-P0 X.b n'%!g]aa]g!%'n b.X P0-I2~8#y@\FAKC*V 1BOz*Q$I+xxO88O88f BB(  a6k_y{c;nB 4 *@Z:  0Zw|g.A:.1o G %}a V,Cs>+Uju}kF!GE OK 65Z&Pr@~ZoK,!P Ff**fF P,!KZo@~rPZ&56K O EG!Fk}juU+>sC,V a}% G o1.:.Ag|wZ0 : Z@*4   Bn;c{yk_a6 ( BBf f BB(  a6k_y{c;nB 4 *@////:Z,GzzG,Z:00P00P00KK<<   $#)A-1m4m7:$<=??@??=$<:m7m41A-#)$  lpJֿΓ˓.>>.œȓοKpl   $#)A-1m4m7:$<=??*e ^z@4p{sH%# HS pG49.luOi  Pt \ OZ1ygwUR 5[*%;^ XQn/*$bx?\"Z^l x@@xl ^Z"?\x$b/*nQX ^;%*[5 RUwyg1ZO\ tP i Ou.l49Gp SH #%H{s4p@z^e **e ^z@4p{sH%# H     00P00P00ccd:cc1ddtdciiAjjijijԄ!8H_o90ܒדeN+˹EE++++W" #'*-037;>CFKQW\_bhnty~ !&+/37;?CGKOSW[_cgkosw{'))0123456789ABCD*#PT!W@&$,<^mmmmBBBBBBBBBBBBBBB;;;;;;;BBBBBBBBBBBBBBBBBBBBBBBBBBiiiiLLLLLLLLLLLLLLLiiiiiiiLLLLLLLLLLLLLLLLLLLLLLLLLLhh2/%<IVr]dky 7^]BBBGBEwY+K~ks###""#T#b#<,0000+00y,000++-00--00000-Y-;mDmDmDmDmDmDmDmDmDmDmDmDmDmD;mDmDmDmDmDmDmDmDmDmDmDmDmDmD9mDmDmDmDmDmDmDmDmDmDmDmDmD@mDmDmDmDmDmDmDl9mDmD<8=>@@mDmDmDmDmDmDmD=w@?mDmD@@9\>>y?mDC?mD&9mDmDmDmDmD AwAA~CCmDmDmDmDmDmDmDCP<mDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmD^BmD|BBBdCE;;E;;E;;mD==>,>D>{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{g2W88gvv` e @(}#!N0 DABCDEFHILM N O P Q S.=?TVWXYZ+&%-#*\BCDFGJKL M!P"S#T$W%V&Q!Y'Z(D)E*L+C,Q-R.T/^0U1P2B3A4B5J6K7N8V9Q:G;RV?C@LACBUCWDDEBFCGq9^  30a !3'=x__d-C,@X` ,0''|d^d^d^d^<+  2 -  72 20F(IF  !#$%&'(()k*+0123__45/67#89:<=>?@AFGSZ[ \ ]^_`cK, ` @ %.@8AK `T@] gpy@]b*h`mr w@}5jՑ @ u@J @U,IZs ~()*+,-. /0&152=3F4P<f=s>?@@ABPQRZ[\+]`^>_Q`kd]]]^]^^^]^]^^^^^^^] @|! 1BSS~~TDRDNONEV42BV44 @ `@O S W [ ` e @i n !r w @|  k@UyiBjbkdlD mf@nh}jlFn `   % . @8 A K `T ] g p y @ BCDEFGZ[^3o y@yAy@B<@@    * J 8   2 v  i  2 2 2 3 3 3 2 3 2 3 2 < < 1< E< {< < < < < OUT OF AREAPAYPHONEPRIVATE"$)+68>@LNSW]amqy}   ()*+,-./01234<=>?@ABFGPQRZ[\]^_`d 568[\]^CHbKMdE6L JRPQISpTw 1<={Y ~  &alTWP sS !F"Q#$%&'(.)i*+,--.R/0X12345%6'7589:;<=>?I@+AUV^DBhFNOXY7Z[O\3][^N_"`a bcdGefg h_itjkElmnopqrWtuvCwxyz{|}/~!#$)28@ADKLMZcfkoqrxz|꥿ħ©jm}sX T 5T [T sT T T T U U U #V iV T V PW W DX X V T S  123A456B789C*0#D$!1"2#3ABCD4X m b x ѐ ؎ 9 9 I Ǐ  Ǐ  8888aaaaTTTTɟ 1 M ɟ i ɟ ɟ ͝ ɟ ɟ ɟ ɟ ɟ ɟ ɟ ɟ  ɟ ɟ ɟ ɟ | Ѧ  + : b y PRIVATEOUT OF AREAPAYPHONEVOICE CALLRING BACK WHEN FREEMESSAGE WAITINGUNKNOWNINCONNUEMOBILEMOBILETGORDINAIREPRIORITAIREDONNEESTESTPUBLIPHONE 1 c z ɯ  ! }    ^  ( 4 @ L X d p | =KCS?OGW>NFVBRJ Y J\a9 ]!` 0hhs8"zE% j!DD!j% Ez"e>e= ik?B,AuVC9l g 77g  /  i  S`ޣ{    ) F* ) * * "* * * ) : 5 %5 e5 5 5 K7 K7 %6 V6 6 6 6 7 K7 K7 K7 : K7 K7 K7 K7 K7 K7 K7 K7 j7 j7 Z7 Z7 Z7 Z7 Z7 Z7 k8 8 8 Z7 7 7 7 8 38 O8 8 8 4; B; 4; "; (; ;; 4; "; KF AF AF AF F F AF AF F F  "%)-27<BIPXakv3Qs Vl$V LLT!%(,[1K6;ADH~OqW/`ibt!3'=x__d-,,C,@X` ,0''|d^d^d^d^%<!3'=x__-C,@X` ,0''|d^d^d^d^< @1`< =@{`)Y /~@;B`H O@[j `r x&@~al` @T`    W @ P s`S @F`Q @ `  '!@"0.#$?i`%%J ''Q(@)Z-*+aR`,,i ..pX/@0w12`33 556@7%89'`::5 <<=@>?@h`AA CCbD@EFGd`HH6 JJ K@L MN`OO QQ%R@S-TU5p`VV;w XXCY@ZJT[\7hOqI{3+^\`\[N" #,8AGI P\X`AA`h p_vt}EC  &.7DL/U^!i#$d)28@ADHKLMZcf k+o0;rExPXz^|sy!j'm.}<2<  _P( 57689 @[  \  ]^ <!3!@dssd+6 + 9@X@6X` ,0''6dddd6dddd++++ <2<  ZZZ( 57689@[  \  ]^ !3F ZZd+6(B@X@6X` ,0''6XXXX6dddd&&&&<2<  ZZZ( 55689@[  \  ]^ !3$@ ZZd+6(B@X@6X` ,0''6dddd6dddd&&&&<2<  ZZZ( 57689@[  \  ]^ !3(< ZZd+6(B@X@6X` ,0''6dddd6dddd&&&&<  ZZZ 57689[  \  ]^ !3"C ZZd$6(P@X@6X` ,0''6dddd6dddd&&&&<2<  ZZZ( 53689@[  \  ]^ !3)< ZZd+6(<@X@6X` ,0''6Z&XZ&X6dddd&&&&<2<  ZZZ 53689@[  \  ]^ !3(< ZZd+6(@X@6X` ,0''6nn6dddd&&&&<2<  ZZZ 57689@[  \  ]^ "#3)A ZZd+6(B@X@6X` ,0''6dddd6dddd&&&&<2<  ZZZ(?55689@[  \  ]^!3!CZZd+6 +B@X@6X` ,0''6dddd6dddd++++<2<  ZZZ 55689@[  \  ]^ !3$@ ZZd+6(B@X@6X` ,0''6dddd6dddd&&&&<2<  ZZZ 57689@[  \  ]^ !3!C ZZd+6(B@X@6X` ,0''6dddd6dddd&&&&<2<  ZZZ 55689@[  \  ]^ !3(< ZZd+6(4@X@6X` ,0''6,R,R6dddd&&&&<2<  ZZZ 57689@[  \  ]^ !3(< ZZd+6(B@X@6X` ,0''6P P P P 6dddd&&&&<2<  ZZZ 57689@[  \  ]^ !3"D  ZZd+6(B@X@6X` ,0''6dd6dddd&&&&<2<  ZZZ( 57689@[  \  ]^ !3(< ZZd+6(B@X@6X` ,0''6dddd6dddd&&&&F<2;#A  FF(25?689@[\]^!3"Bnnd+6+ B@ @6X` ,0''6++++A<A2A#A  _2(2576A89[  \  ]^!3$@2ddd,6 +BpXp6X` ,0''6dddd6dddd++++<AR?@A1D^EFoGHINJKLPMNOTP$QbR[S>TbUVaWX'YZp[]\Q]^_`RabXcd efgh`i mUjk<lnodpTqr4sytuqvwx_yz{W|}@~/\S3?0_y(szztA"^U .)vBuZv|,V{:T{})- - - &- -- 4- ;- - - z- l- ^- e- W- s- ; < 5< i< < < < < > %? ? k? H? ;B B ]B B B B I LH H H I QI I J I >J nJ J YK K K K L .N M DO jO O O O P P 5Q Q &R wR Q B C GC mC C C C (D qD D )E E E >F F F yY yY yY yY HS vS S S b= = 9> [> w> ? A ; ; ?L aL L L L = R R yY yY yY yY yY yY yY yY yY BG G G bT T 3T T yY T T > U X X W >X gX X X W W =U yY U ,P = ? 8@ @ A = ?= > "K \U cU jU qU xU U U U U U U U U UU Y Y Y 3Z UZ wZ Z Z + Z K[ [ \ + b\ t[ \ $[ [ [ \ \ ;\ d^ ^ ^ =^ ^ ^ ^ _ a_ ?_ _ + + _ ` \ 4] B` d` ] ` ` g =g ]g |g + g + g k _m m m m j 8n mn n p q q Sq |q k k k *l pl l m 3p \p p p q u "u Du fu u #v v v 3w xx x x x y "y [y y y Jz z { { 7| | | } c}  + } } 5~ w~ ~ j 6 n  P P  E   : π  s ˄ V х M  V + + Lj " K Y  O + 9 | ƍ ׋ ƌ  ɏ E g Đ  ~ D = Đ + . t E A k  = j ) ] ŗ } ; ͘ + | A h W  , w M  ɟ  T + Ԡ  : \ ɡ  D n ʣ / c ` e @ X y r f _ ά ά ά ¬ ɬ ¼ ǽ ҽ ٽ < & & & & % T% ]% f% o% x% % % $*0610 %1d =? +VCID:(0-2) ID?= %b %s, %s, %2h %s ID:%H North America Country Code %3b Bell212UnknownBell103V.21V.22V.23V.32/V.32bisV.34/V.34+X2(tm)V.90V.92k56Flex(tm)V.27V.29V.17V.34HDXV.34HDXC No Previous Call %s %s%1d S%2d:%b ACTIVE PROFILE:STORED PROFILE 0:STORED PROFILE 1:2 = %s 3 = %s S%3d:%10l(%10x) S%3d:%10l %2H %10l(%10x) Dialing...%sGMIGMMGMRGSNGOIGCAPGCIIPRICFIFCILRRILSDIDSRIBCIBMITFASTOMSCMSMAMREBESRESAESEFCSERETBMEWINDEFRAMDS44DSDRTE140TE141TERDLTALSTDLSTRDLSTLDLTRDLTALTSELFTRESPCWPMHTPMHRPMHFPMHPIGPQCPSSA8EA8M=A8TFCLASSFRS=FTS=FTM=FRM=FTH=FRH=FAEFPRFLOFMMFMIFMRFMDLFMFRFREVFAACWTVCIDVRIDVNHVIPVRXVTRVTSVTXVGRVGTVITVLSVRAVRNVSDVSMVTDVDRVDTVSPVGMVGSVTAVTHVDXVEMBLMENQVWXY&C&D&G&J&K&L&Q&S%C%E\J%c PROTOCOL: %s %s COMPRESSION: %s CONNECT 52000 CONNECT %s V42bis V44 V42 MNP5 MNP4 NoEC /ARQ %d %c %c CARRIER %s/%s CARRIER %s +PMHR:%L +PMHR:0 PH.324 video-ready rev. 1.0Not AvailableData/FaxNONELAPMALTV.42bisCLASS 5V.44V.42bisV.44MNP5NONELAPMMNPUnknownNo Previous CallCall Is Still In ProgressCall Waiting Signal DetectedHardware FailureInactivity Timer ExpiredDTR Is LowDTR DropNo Number ProvidedBlacklistedCall Attempts Limit ExceededExtension Off-hook DetectedConnection TimeoutIncoming Call DetectedNo Loop CurrentNo Dial ToneVoice DetectedReorderSit ToneLine BusyLong Space DisconnectCarrier LostTraining FailedNo Modulation In CommonRetrain FailedCleardown ReceivedFax DetectedUser InterruptHangup Command IssuedReset Command IssuedBad FrameNo Error Control EstablishedProtocol ViolationNegotiation FailedDisconnect Frame ReceivedSABME Frame ReceivedSynchronization Loss %1d (0,1) %c%c %s ,%D =? (0,1,2) (0,1,2,4,8,10,18) Blacklisted: %s %2d hours %2d:%2d min Blacklisted Permanently: %2d; %s %c %2d; %s Delayed: Failed: %s +GCAP:+FCLASS,+MS,+ES,+DS %s ? +PSS:2 +PSS:0 =? +PSS:(0,2) +PMHT:%L +EFCS:0 +EFCS:(0) +ESR:%L +ESR:(0,1) +MSC:%L +MSC:(0,1) +ICF:%1l,%1l +ICF:(0,1,3-5),(0-3) +DR: %s %s +ER:LAPM +ER:ALT +ER:NONE +PIG:%L +PIG:(0,1) +PMHR:%L +PQC:%L +PQC:(0,1,2,3) +PMH:%L +PMH:(0,1) +PCW:%L +PCW:(0,1,2) +DR:%L +DR:(0,1) +ER:%L +ER:(0,1) +MR:%L +MR:(0,1) +IDSR:%L +IDSR:(0,1) +ILSD:%L +ILSD:(0,1) +ILRR:%L +ILRR:(0,1) +IFC:%L,%L +IFC:(0-2),(0-2) +DS:%L,%L,%L,%L +DS:(0-3),(0),(512,%L),(6-32) +DS44:%L,%L,%L,%L,%L,%L,%L,%L,%L +DS44:(0-3),(0),(0),(512),(512),(32-%L),(32-%L),(%L),(%L) +EFRAM:%L,%L +EFRAM:(%L +EWIND:%L,%L +EWIND:(1-31),(0) +ETBM:%L,%L,%L +ETBM:(0-2),(0-2),(0-254) +EB:%L,%L,%L +EB:(0-3),(0,1),(0-255) +ES:%L,%L,%L +ES:(0,1,2,3,4,5-6),(0,1,2,3),(0-3,5,6,7-8 +MCR:%s +MRR:%L,%L +MSC:%D +MA:,%s +MA:(90 1 (Auto Rate) %L (%L) 0 (Disabled) [0-23] +MS:%s,%L,%L,%L +MS:(),(0,1),(0,%L-%L),(0,%L-%L) +ASTO:%D,%s +ASTO:(0-3),(%L) +IPR:%s +GCI:%2h +GCI:(%2h,%2h +GCI:(%2hV92V90V34V32TV32BV32V22BV22B212V23CV21B103 +A8J:1 +A8A:1 +A8A:2 +A8M:0 +A8C:%D +A8A:%D +A8T:,,,%L,%L,%L =? +A8I:%H +A8C:3 +A8M:%s +A8R:%L,,%s +A8E:%L,%L,%H,%L," +ESA:%L,%L =? +ITF:%L,%L,%L +IBM:%L,%L,%L +IBC:%LDRONDROF %s=%D CPOF=%D CPON=%D TXASTB=%D %D 0,1 %D,%D (0,1),(0-60) (0-200) (0,122-148),(0-255) (0-255) (0-600) (%D,%D-%D) (0,1) 0,"Signed PCM",16,00,"Signed PCM",8,04,"G.711U",8,04,"G.711A",8,0,"IMA ADPCM",4,0 %s,%D,%D,%D %s=%s %2h DATETIMENMBRDDNCALLNAME MESG = %D (0,1) 0,1 (0,255) %L %D,%D,%D DE %1b 0-3 0OK1CONNECT2RING3NO CARRIER4ERROR6NO DIALTONE7BUSY200RRING201NO BONGTONE202REORDER203WARBLE89BLACKLISTED88DELAYED33FAX35DATA204CALL WAITING DETECTED205NO LINE CURRENT+F4+FCERROR8NO ANSWER170RING A171RING B172RING C173RING D2240951011241225138614555657585960281887909192989910010110270103104721051067410710876109110781111128011311482115206207208209210211212United StatesAustraliaBelgiumDenmarkFinlandFranceGermanyNetherlandsItalyNew ZealandNorwaySpainSwedenSwitzerlandUnited KingdomAustriaJapanChinaKoreaMalaysiaSingaporeTaiwanThailandIndonesiaPortugalIrelandHong KongCanadaMexicoIndiaVietnamPhilippinesGreeceHungaryTurkeySouth AfricaPolandSloveniaSlovakiaCzech RepublicLuxembourgBrazilBulgariaCyprusIcelandRussiaIsraelSaudi ArabiaPakistanArgentinaBoliviaChileColombiaEcuadorPanamaPeruLiechtensteinUnited Arab EmiratesKuwaitOmanLebanonEgyptBangladeshSri LankaLatviaLithuaniaEstoniaRomaniaMaltaMoroccoEuropeVenezuelaUruguayEl SalvadorHondurasGuatemalaDominican RepublicParaguayPuerto RicoBritish Virgin IslandsCosta RicaNicaraguaAzerbaijanJordanUkraineTunisiaBelizeJamaicaHaitiCayman IslandsArubaBahamasBarbadosSaint LuciaTrinidadGrenadaBruneiBelarusCroatiaSenegalBahrainKenyaMonacoQatarGibraltarPapua New GuineaGeorgiaKazakhstanKyrgyzstanTajikistanTurkmenistanUzbekistanSerbia and MontenegroAlbaniaAlgeriaAngolaAntigua and BarbudaBeninBermudaBotswanaBurkina FasoBurundiCambodiaCameroonCape VerdeCentral African RepublicChadRepublic of the CongoDjiboutiEquatorial GuineaFrench GuianaGabonGambiaGhanaGuadeloupeGuamGuineaGuinea-BissauGuyanaCote d'IvoireLaosLiberiaMadagascarMaliMartiniqueMauritiusMozambiqueNamibiaNepalNetherlands AntillesNigerNigeriaRwandaSao Tome and PrincipeSierra LeoneSaint Kitts and NevisSurinameSyriaTanzaniaTogoUS Virgin IslandsYemenZimbabweBosnia and HerzegovinaEast TimorMacauMalawiNew CaledoniaSwazilandlinux_modem_cleanup()SMD.c[%s:%d:%s] Buffer of size %d:0123456789ABCDEF%slinux_modem_init()LXModemMinorDevNumToPtr()SMDModem.c[%s:%d:%s] LXModemPtrToMinorDevNum()LXModemCleanup()LXModemCanStop()linux_modem_close()linux_modem_open()LXTTYDeviceLXModemInit()reset Err 2 1@ %x Err 3 diffPtr < 0 1z 2@ %x 3@ %x ****USB Disconnect x_usb_stop_dma STREAMING ENDED BALA Usb_StopIsoDma *****USB***** uss_delete ERR: BUFFER_SZ Less %d %d cmd retval=%d reset enpoint 0x%x retVal %d ERR: Write err dev NULL ** i = %d ERR: rx_object NULL ERR: URB NULL ERR: BUFFER NULL ERR tx_object NULL URBS %d x_usb_start_dma return BALA IsoUsb_StartIsoDma EEErrr BHhhhh Errrrrrrrrrr %lx: %lx * Download Bulk Patch! gRomVersion=%x U2 Rom Code Version %d.%d.%d *** Usb_StartIsoDma End %d BALA U2InitGpio BALA U2SetEnumerationLED BALA Usb_HandleStartDevice ===> set config, done ===> set interface, done ==> usb_device_speed = %d get_iface_desc, done ==> bNumEndpoints = %d *****USB***** PROBE: Loop %x LXHardwareCommonGetIRQ()SMDHardware.c[%s:%d:%s] LXHardwareCanStop()LXHardwareBottomHalf()received len = %ld Received AA55 WCB return %d LXHardwareCommonStopISR()LXHardwareCommonStartISR()LXHardwareCommonStop()LXHardwareStop()Device%dAGRSMDMSetupGlobalSOFTWARE\Agere\SoftModemAGRSMDMSetupCodecFlags==> codecType = 0x%x USB2.0SV92U2LXHardwareCommonStart()LXHardwareStart()LXHardwareCommonDestroy()LXHardwareDestroy()LXHardwareLXHardwareCommonLXHardwareCommonCreate()LXHardwareCreate()LXHardwareCleanup()LXHardwareInit()LXHardwareInfoDestroy()SMDHardwareInfo.c[%s:%d:%s] AgerePCIPerseusPPAMR Intel MBAC97AMR Via MBAMR SiS MBAMR ALi MBLXHardwareInfoConfigureAMR()LXHardwareInfo[AGRSMDM] Error: AGR USB MDMUSBLXHardwareInfoConfigureUSB()LXHardwareInfoFindDevices()LXHardwareInfoCreate()LXRegistryDumpKey()SMDRegistry.c[%s:%d:%s] LXRegistryDump()LXRegistryGetValueKey()LXRegistryGetNextValue()LXRegistryGetFirstValue()LXRegistryGetParentKey()LXRegistryGetNextKey()LXRegistryGetFirstChildKey()LXRegistryInit()LXRegistryGetValueData()LXRegistryRemoveValueData()LXRegistryValue->data.sz.dataLXRegistrySetValueData()LXRegistryDestroyValue()LXRegistryDestroyKey()LXRegistryCleanup()LXRegistrySetValueName()LXRegistrySetKeyName()LXRegistryGetValueName()LXRegistryGetKeyName()LXRegistryGetValueByName()LXRegistryValueLXRegistryCreateValue()LXRegistryGetChildKeyByName()LXRegistryKeyLXRegistryCreateKey()LXSoftModemSetRingState()SMDSoftModem.c[%s:%d:%s] LXSoftModemCleanup()LXSoftModemCanStop()LXSoftModemPerformTXBreak()LXSoftModemPerformTXFlush()[AGRSMDM] Error: LXSoftModemStart()LXSoftModemInit()LXSoftModemDestroy()LXSoftModemStop()LXSoftModemPerformRXClear()LXSoftModemGetTXBufRoom()LXSoftModemPerformTXClear()LXSoftModemLineHandler()LXSoftModemPerformTX()LXSoftModemChainEyeHandler()LXSoftModemChainLogHandler()LXSoftModem->stateMemPtrLXSoftModemLXSoftModemCreate()LXHeapUpdateMaxStats()SMDHeap.c[%s:%d:%s] LXHeapPageListDestroy()LXHeapReportMaxStats()LXHeapCleanup()LXHeapNodeInit()LXHeapPageListCreate()LXHeapNodeUse()LXHeapAlloc()LXHeapNodeUnuse()LXHeapFree()ActiveModemsSOFTWARE\Agere\SoftModemStatusAGRSMDMSetupLastCloseTimeV92DataModemProfilePCMLLSaveDisabled\_min_maxHomolTimeStampDisableWORDisableStandbyTAPICountryIDMirrorMatchingDeviceidMsgAppletDisableCountryIDCurrentIDNumEntriesCountryIDMSCurrentCountryGMIResponseGMMResponseGMRResponseGSNResponseGOIResponseFMIResponseFMMResponseFMRResponseCallProgressPlayThresholdWasRebootDisableWaitForDialToneDefaultSetSpeakerVolumeMaxATIxResponseBell 212unknownidlev.8v.21v.22/v.22bisv.23v.25v.27terv.29v.17v.32/v.32bis/v.32terbov.34v.34 half-duplexX2 PCMv.90v.92k56FlexBell 103AltoComMotorolaUnknownRockwell/Conexant3ComLucentCisco (MICA)ADIBay NetworksMHcdaMHfrrMHreqMHackMHnackMHclrdunknown MH signal %ld%2.2lx%c%ld.00%ld%c%ld.0%ld%c%ld.%ld%c%ld.0625NaN0.001.00****0.%03lde%+2d0.%1lde%+2d%s Sampling rate: %6ld Hz Modulation: %s Rx symbol rate: %6ld Hz Tx symbol rate: %6ld Hz RxRate: %5ld bps TxRate: %5ld bps Error # %ld V34 exception: %8lx CP sentCP' sentJp detected: %4x %4x Jd detected: %4x %4x Digital modem guess: %s MP' detectedMP detectedMP' sentMP sentCPt detectedCPs' detectedCPs detectedCP' detectedCP detectedSUVd' detectedSUVd detectedCPd' detectedCPd detectedSUVu' detectedSUVu detectedCPu' detectedCPu detectedCPShort' detectedCPShort detectedSUVd' sentSUVd sentCPd' sentCPd sentSUVu' sentSUVu sentCPt sentCPu' sentCPu sentCPShort' sentCPShort sent%4x E detected %4x R-sequence detected %4x R-sequence sent %4x Automoder trying %s sourcereceptionnlc---prcexpminauxMax local Rx data rate %5ld Max local Tx data rate %5ld Max remote Rx data rate %5ld Max remote Tx data rate %5ld recipientfor unlimitedfall back to V.8for 10 sfor 20 sfor 30 sfor 40 sfor 1 mfor 2 mfor 3 mfor 4 mfor 6 mfor 8 mfor 12 mfor 16 m%s detected %s sent V92 QCA1d detected %lx V92 QC1d detected %lx V92 QCA1a detected %lx V92 QC1a detected %lx Training progress code %ld Hybrid Delay setup: %s ms Round Trip Delay : %s ms Hybrid Delay : %s ms Rx Signal Level: %s dBm L1/L2 noise ratio: %s dB Timing Offset : %s ppm Frequency Offset: %s Hz Signal/Noise Ratio: %s dB Signal/Echo Ratio: %s dB DC Offset: 0x%lx Total Rx Power: %s dBm %2.2xenableddisabledSeamless Rate Change: %s PCM pad value: %ld dB PCM RBS map: 0x%6.6lx V34 Eql Length: %d V34 Eql Offset: %d PCM Ieec Length: %d PCM Ieec Offset: %d Test checksum = %lx DTMF %c Custom signal %lx ONOFFHook switch %3s Pulse shunt relay %3s Illegal dial modifier: %c Speaker %3s V.24 circuit %3ld ON V.24 circuit %3ld OFFI/O status code %ld AT debug status code%s %ld DTE rate set to %ld default lengthlength = %ld msLAPM test result: %ld LAPM TxFRAME l=%3ld LAPM RxFRAME l=%3ld INFO (ns=%d, nr=%d)RR, nr=%d)RNR, nr=%d)REJ, nr=%d)SREJ, nr=%d)%2x LAPM status %ld MNP status %ld MNP protocol level: %1ld MNP service class: %1ld V80 status %ld transmitreceiveRing Frequency: %6ld Hz Caller ID error %4ld Caller ID: name: %s Caller ID: UK Call Type: %s Caller ID: Origine: %s V8bis +A8R:%ldV8bis sent QCA %lx V8bis sent QC %lx V8bis detected QCA %lx V8bis detected QC %lx V8bis status %ld, value %ld Overcurrent threshold: %ld mAAT Response %ld AT Response: %s AT Command: %s AT Command FRM = %ld Framer mode: %lX Logging started. File: %s %s %ld MB DMA integrity check failedCodec Status: %s Retraining ForcedCodec stoppedCodec restartedConnection Status Info%s %ld : Modulation: %sData rate: %ld / %ld bpsSymbol rate: %ld / %ld HzRetrains requested: %ldRetrains granted: %ldSignal Level: %ld / %ld -dBmRound trip delay: %ld msSNR: %ld dBChar count: %ld / %ldFrame count: %ld / %ldFrame error count: %ld / %ldProtocol: %sFrame size: %ldCompression: %sDisconnect reason: %sDigital modem type: %sUnknown code %ld code # %ld value %ldStatus code %ld, value %ld in UART_init App PID = %d Unknown errorLIN_ERROR_NONELIN_ERROR_FAULTLIN_ERROR_NOMEMLIN_ERROR_NODEVLIN_ERROR_BUSYLIN_ERROR_IOLIN_ERROR_RESTARTSYSLIN_ERROR_AGAINLIN_ERROR_INVALLIN_ERROR_NXIOLIN_ERROR_NOIOCTLCMDLIN_ERROR_PERMLIN_ERROR_PCIBIOS_SET_FAILED#### Val= %xvxd - 16550 break intvxd - modem status intvxd - 16550 report breakLXUARTio_app_tx_count = %dw_count = %dr_count = %dcount = %dWrite count = %d(null) Register 0x%2h = 0x%4h %2h: %4h Register 0x%2h = 0x%4h %2h: %4h SV92A3 registers dump: Page 0: %2h:%4h Page %d: %2h:%2h %2h: %2h %2h: %4h Register 0x%2h = 0x%4h SV92A2 registers dump: %2h: %4h OffHook_W Mercury registers dump: CIOCA: %4h CIOCB: %4h Read dsp ram(%4h): %4h Read register(%2h): %2h OCPEnableSOFTWARE\Agere\SoftModemMercury MerLite registers dump: CIOCA: %4h CIOCB: %4h Read dsp ram(%4h): %4h Read register(%2h): %2h OCPEnableSOFTWARE\Agere\SoftModemMerLiteSilabs Register %2d = %2h Read dsp ram(%4h): %4h Read register(%2h): %2h Si3034 registers dump: %2d: %2h SV92PP registers dump: %2h:%4h %2h:%2h %2h: %2h Page 0: %2h:%4h Page %d: OK %2h:%2h %2h: %2h %8h OK %2h:%4h Perseus Read dsp ram(%4h): %4h Read register(%2h): %2h Read dsp ram(%4h): %4h Read register(%2h): %2h DCOffsetOffHook_WPerLiteDescription Status --------------- ------------ Last Connection %s Initial Transmit Carrier Rate %s Initial Receive Carrier Rate %s Final Transmit Carrier Rate %s Final Receive Carrier Rate %s Protocol Negotiation Result %s Data Compression Result %s Estimated Noise Level %L Estimated Signal/Noise Ratio (dB) %2b Receive Signal Power Level (-dBm) %2b Transmit Signal Power Level (-dBm) %2b Round Trip Delay (msec) %L Near Echo Level (-dBm) %2b Far Echo Level (-dBm) %2b Transmit Frame Count %L Transmit Frame Error Count %L Receive Frame Count %L Receive Frame Error Count %L Retrain by Local Modem %L Retrain by Remote Modem %L Rate Renegotiation by Local Modem %L Rate Renegotiation by Remote Modem %L Call Termination Cause %L Robbed-Bit Signaling %H Digital Loss (dB) %2b Remote Server ID NA Connection Time (sec) %L.%L TELEPHONE NUMBERS: 0 = %s 1 = %s SPECIAL CONFIGURATION REGISTERS: INTERNATIONAL CONFIGURATION REGISTERS: Retrain Attempt Count ExceededFrame Retransmition Count Exceeded +PMHT:(0,1,2,3,4,5,6,7,8,9,10,11,12,13) +IPR:(0,300,1200,2400,4800,9600,19200,38400,57600,115200,230400,460800,921600) +A8T:(0-10),(64),(64),(0-2),(0-1),(0-1) +A8E:(0-6),(0-5),(1),(0-2),("6"),("1") +ESA:(0-2),(0,1),(0,1),(0,1),(0-2),(0,1),(0-255),(0-255) +ITF:(0-%L),(0-%L),(0-65535) +IBM:(0-7),(0-65535),(0-65535) +IBC:(0-2),(0,1),(0,1),(0,1),(0,1),(0,1),(0,1),(0,1),(0,1),(0,1),(0,1),(0,1),(0,1) 0,"",00000000,00000000,023C1278 1,"T",00800000,003C1630,023C1278 3,"LT",00800000,003C1630,023C1278 5,"SLT",00800000,003C1630,023C1278 0,"Signed PCM",16,0,%D,(0,122-148),0 4,"G.711U",8,0,%D,(0,122-148),0 5,"G.711A",8,0,%D,(0,122-148),0 %3d,"IMA ADPCM",4,0,%D,(0,122-148),0Democratic Republic of the CongoSaint Vincent and the GrenadinesLocal stack frame prefix corrupted!Local stack frame prefix corrupted!Usb_CopyPlayBuf() play dma buffer not in range pDma= %lx gDma= %lx Usb_CopyPlayBuf() play dma not multiple of 96 - ends pDma= %lx gDma= %lx Usb_CopyPlayBuf() invalid TransferObject index %d- ends Usb_CopyPlayBuf() rdptr not same pOldPlayDmabuffer= %lx pPlayDmabuffer= %lx diffptr=%lx Usb_CopyPlayBuf() diffptr= %lx > transferbuffersize= %x Usb_CopyPlayBuf() nSamplesAvailable= %lx > transferbuffersize= %x Number of times Write/Read performed=%d ERR: Control Interface failed ERR: Control Data Buffer NULL %s - failed submitting control urb, error %d%s - failed submitting read urb %d, error %d%s - failed submitting write urb %d, error %d*****USB***** uss_write exit retval %d x_usb_start_dma pRecDmabuffer %x pPlayDmabuffer %x Uss_JustSetWorkAround() - can not read memory @ 0 Uss_JustSetWorkAround() - command failed @ 0 Uss_InitForUsingBulkEps() - download workaround Uss_InitForUsingBulkEps() - exiting without download * ROM code version 1.0.6 found, download bulk patch for it Bulk Patch downloaded already! Uss_InitForUsingBulkEps() - download workaround failed @ 0 Reading gfunctable after bulk download @ addr %lx Uss_InitChangeClockCmd - download workaround Uss_InitChangeClockCmd() - exiting without download ChangeClockCmd Patch downloaded already! Uss_InitChangeClockCmd() - download workaround failed @ 0 Reading gfunctable after aync cmd download @ addr %lx USS_CMD_CHANGE_CLK command failed USS_CMD_CHANGE_CLK command passed USS_CMD_CUSTOM_ASYNC command failed USS_CMD_CUSTOM_ASYNC command passed Usb_LowerArmClock(): Arm running on USBCLK XTAL Usb_BoostArmClock(): ARMCDR Reg= %x, clock running @ %d Mhz Usb_BoostArmClock(): Arm running on USBCLK XTAL, PLL not locked !! Set clk src & divider val manually BALA Usb_StartIsoDma pRecDmabuffer %x pPlayDmabuffer %x *=====> Probing. Interf 0x%x ==> x_usb_get_dev(), returns = 0x%x *****USB***** PROBE: bEndpointAddress %x *****USB***** PROBE: bmAttributes %x *****USB***** PROBE: wMaxPacketSize %x *****USB***** PROBE: Bulk IN endpoint %x ***ERR*** Could not allocate bulk_in_buffer*****USB***** PROBE: Bulk OUT endpoint %x ***ERR*** Could not find both bulk-in and bulk-out endpoints*****USB***** PROBE EXIT : USS2828 device now attached *****USB***** PROBE EXIT : Error %dLocal stack frame prefix corrupted!Bulk: received len > 50, len= %ld Bulk: received len < 48 words, len= %ld !!!!!!!!!!!!!!!!!!!!1*** valid samples received **&&&&&&&&** len = %ld No of samples received is not equal to 96 actual gTotalsamplesreceived= %d gSendLessSamples= %d %s ERR: *****USB***** nonzero write bulk status received: %dBALA - WCB submitting write urb, error %d packet_count %u ERR: *****USB***** nonzero read bulk status received: %d BALA - RCB submitting read urb, error %d packet_count %d LXHardwareCommonReleaseResources_AMR()LXHardwareCommonReleaseResources_PCI()LXHardwareCommonObtainResources_PCI()LXHardwareCommonObtainResources_AMR()Local stack frame prefix corrupted!LXHardwareInfoConfigureSoftPCI()lin_pci_dev_get_subsystem_id() failedLocal stack frame prefix corrupted!LXRegistryValue->data.bin.dataLocal stack frame prefix corrupted!LXSoftModemRegisterMCRChange()Unable to put SoftModem in AT command mode!LXSoftModemUnchainEyeHandler()LXSoftModemUnchainLogHandler()LXSoftModemUnchainStatusHandler()LXSoftModemEyeHandlerChainNodeLXSoftModemLogHandlerChainNodeLXSoftModemStatusHandlerChainNodeLXSoftModemChainStatusHandler()Unable to set SoftModem log handler!Unable to set SoftModem eye handler!LXSoftModemRunStatusHandlerChain()Local stack frame prefix corrupted! AC97WriteGPIO register: %8h AC97ReadGPIO register: %4h SOFTWARE\Agere\SoftModem\Country\SOFTWARE\Agere\SoftModem\PhoneDirectory\v.34 half-duplex control channelRx carrier frequency: %6ld Hz Tx carrier frequency: %6ld Hz Tx preemphasis filter: %6ld Tx power adjustment: %6ld dB Remote Tx preemphasis filter: %6ld Remote Tx power adjustment: %6ld dB Non-periodic RBS detected at position %1ldAutomoding completed, selected %s Rockwell compatible bitmap: %lx V34 half duplex %s rates -- %d %d %d V8 (V34 Phase 1) finished, modulation %s V34 Phase 2 detected Periodical while looking for Ack in repeated INFO0's V34 Phase 2 detected INFO%d sequence V34 Phase 2 detected near end echo, detected value = %ld, 40ms turn-around uses %ld V34 Phase 2 finished, modulation %s V34 Seamless Rate Change Request Sent: %4lx V34 Seamless Rate Change Update Sent: %4lx V34 Seamless Rate Change Request Received: %4lx V34 Seamless Rate Change Update Received: %4lx V34 encoder parameters: %s %s %s %s %2dS J=%1d P=%2d b=%2d r=%2d q=%1d K=%2d M=%2d V34 decoder parameters: %s %s %s %s %2dS J=%1d P=%2d b=%2d r=%2d q=%1d K=%2d M=%2d Projected data rate for %4d symbol rate, is %5ld bps (in-band SNR = %s dB) V92 phase2 recognized connection : threshold %ld / noise %ld / offset %ldV92 phase2 did not recognize connection : threshold %ld / noise %ld / offset %ldV34 half duplex %s side phase 3 started V34 half duplex %s side phase 3 finished V34 half duplex control channel consecutive binary 1 detected V34 half duplex primary channel consecutive binary 1 detected V34 Phase 2 notch detected @ %s HzModem-on-Hold: going on hold: %s V34 phase 2: return to V8, unknown code %ld Symbol rates bitmap: %8lx Data rates bitmap: %8lx Features bitmap: %8lx Auxiliary features bitmap: %8lx Demod. capabilities bitmap: %8lx Rate threshold adjustment: %8lx Xmt level adjustment: %8lx Capabilities status code %ld value %lx Near Echo Signal Level: %s dBm Far echo + residual near echo Signal Level: %s dBm Remote modem reported frequency offset: %s Hz PCM phase 2 analog detector SNR: %s dB PCM phase 2 digital detector SNR: %s dB PCM phase 2 digital detector SNR with 60Hz harmonics removed : %s dB PCM phase 2 digital detector SNR with 50Hz harmonics removed : %s dB PCM phase 2 RBS detector SNR: %s dB Equalizer center tap offset: %ld PCM Spectral Shaping Bits: %1ld DataModem loopback self test bit error rate: %1ld.%2.2ldE-6 Band edge distortion metric: %d Band edge corrector selector: %d Modem : %ld bits / %ld blocks received; %ld bit / %ld block errors; BER: %s ; BLER: %s Modem : %ld bits / %ld blocks received; %ld bit / %ld block errors; BER: %s ; BLER: %s Audio : %ld bits / %ld blocks received; %ld sync/ %ld block errors; SER: %s ; BLER: %s MultiTone detected(%ld,%ld): %4ld %4ld %4ld %4ld DisablePendingCallWaitingMessage: Setting pCodec->reportCallWaitingAfterCid to false External Pulse Dial: %2ld make=%3ldms brake=%3ldms Local country code changed: %ld Break received (expedited/destructive) %s Break received (expedited) %s Break received (nonexpedited) %s Break received (unknown type) %s LAPM Tx: %ld frames sent; %ld frames retransmitted LAPM Rx: %ld frames received; %ld frames rejected LAPM xmt sliding window size: %3ld LAPM rcv sliding window size: %3ld LAPM xmt max info field size: %3ld LAPM rcv max info field size: %3ld LAPM Tx compression dict. size: %3ld LAPM Tx comp. max string size: %3ld LAPM Tx comp. max history size: %3ld LAPM Rx compression dict. size: %3ld LAPM Rx comp. max string size: %3ld LAPM Rx comp. max history size: %3ld V42bis Encoder statistic: %ld bytes in / %ld bytes out V42bis Decoder statistic: %ld bytes in / %ld bytes out V44 Encoder statistic: %ld bytes in / %ld bytes out V44 Decoder statistic: %ld bytes in / %ld bytes out MNP Tx: %ld frames sent; %ld frames retransmitted MNP Rx: %ld frames received; %ld frames rejected MNP Timeout. Last Sent=%ld,!Ack=%ld. Retransmitting from frame %ld MNP Retransmit from frame %ld. %ld frames pending MNP max info field size: %3ld MNP sliding window size: %3ld Hardware Configuration(S597) changed: 0x%lX V80 Tx: %ld frames sent; %ld frames retransmitted V80 Rx: %ld frames received; %ld frames rejected Audio frames lost: %ld frames Audio Rx buffer underflow. Req %ld bytes, Avail %ld bytes Audio Rx buffer overflow. Req %ld bytes, Avail %ld bytes Overlay: time elapsed: %ld ms reported to data pump; %ld ms actual Overlay: recorded %ld ms of %s data Overlay: replayed %ld ms of %s data Caller ID error: checksum error 0x%4lx Caller ID: %ld bytes of channel seizure received Caller ID: %ld bytes of mark signal received Caller ID: IDtime: %c%c/%c%c, %c%c:%c%c Caller ID: telephone number: %s V8bis frame longer than rx buffer size (%ld) V8bis frame less than 3 bytes (received %ld bits) V8bis frame not integer number of bytes (received %ld bits) V8bis remote revision number %ld AT Command FRH = %ld, FRH0 state AT Command FRH = %ld, FRH1 state Codec Status: DMA desynchronized (nRx: %ld; nTx: %ld) Codec Status: Codec interrupt delayed (hwTime: %ld; osTime: %ld) Codec Status: Watchdog timer fired. %s ( %ld ms elapsed) Codec Status: FIFO Overflow. ( status: 0x%lX ; FIFO depth: %ld) Codec Status: DMA Error. (rcvDmaStatus: 0x%lX; xmtDmaStatus: 0x%lX) Codec Status %ld, Argument 1: 0x%lX, Argument 2: 0x%lXInitial data rate: %ld / %ld bpsCarrier frequency: %ld / %ld HzRate renegotiations requested: %ldRate renegatiations granted: %ldAudio delay: %ld ("audioDelay"=dword:%08lX) Audio hardware: ("pnpId"="%s") ("driverVersion"="%s") ("driverDate"="%s")LIN_ERROR_PCIBIOS_BUFFER_TOO_SMALLLIN_ERROR_PCIBIOS_FUNC_NOT_SUPPORTEDLIN_ERROR_PCIBIOS_BAD_VENDOR_IDLIN_ERROR_PCIBIOS_DEVICE_NOT_FOUNDLIN_ERROR_PCIBIOS_BAD_REGISTER_NUMBERREAD_UART_REG, Unsupported Reg #%d = %x SV92A2 HDA registers dump: Scorpio HDA registers dump: Si3038/3048 registers dump: Write dsp ram(%4h) with %4h Write register(%2h) with %2h Write dsp ram(%4h) with %4h Write register(%2h) with %2h Write Codec reg (%2d): %2h Write dsp ram(%4h) with %4h Write register(%2h) with %2h SV92U2 Polaris registers dump: Write dsp ram(%4h) with %4h Write register(%2h) with %2h Address+1 (%4h) contains %4h Write dsp ram(%4h) with %4h Write register(%2h) with %2h Address+1 (%4h) contains %4h `UdUpUUUUUUVΏ4V@VV{EVV W tWWW/DX`XXܹY@YYZ$Z@ZZϮ4[`[[d\\\jS ]]@^Ϧ5_ __5}-t`` a(yNb@bbcddeffp4%a4pa%#2UDvg#2UDvg                                                                                                  (!)0819  "*#+2:3; !) (1908  #+"*3;2: 0819 (!)  2:3;"*#+ 1908!) (  3;2:#+"* %45 $-<=,'67&/>?. $54 %,=<-&76'.?>/5 $ %4=,-<7&'6?./>4 % $5<-,=6'&7>/.?8091( )! :2;3*"+#  9180)!(  ;3:2+#*"  ( )!8091 *"+#:2;3  )!( 9180 +#*";3:2  =,-<5$ % 4?./>7&'6<-,=4% $ 5>/.?6'&7-<=,% 45$ />?.'67&,=<-$ 54% .?>/&76'0819 (!) 2:3;"*#+  1908!) ( 3;2:#+"*  (!)0819 "*#+2:3;  !) (1908 #+"*3;2:  =,-<5 $ %4?./>7&'6<-,=4 % $5>/.?6'&7-<=, %45 $/>?.'67&,=<- $54 %.?>/&76' ( )!8091  *"+#:2;3 )!( 9180  +#*";3:2 8091( )!  :2;3*"+# 9180)!(   ;3:2+#*"% 45$ -<=,'67&/>?.$ 54% ,=<-&76'.?>/5$ % 4=,-<7&'6?./>4% $ 5<-,=6'&7>/.?0246$& "2064&$" 1357%'!#3175'%#!.(*,: < >8,*(.8>< : /)+-; = ?9 -+)/9 ?= ; 0246$& "2064&$" 1357%'!#3175'%#! : <>8.(*,8> < :,*(. ; =? 9/)+- 9? = ;-+)/4602 "$&6420" &$5713!#%'7531#!'%*,.(>8: < (.,*< : 8>+-/)?9 ; = )/-+= ; 9 ?4602 "$&6420" &$5713!#%'7531#!'%>8 : <*,.( < :8>(.,*? 9 ; =+-/) = ; 9?)/-+$& "0246&$" 2064%'!#1357'%#!3175: < >8.(*,8>< : ,*(.; = ?9 /)+-9 ?= ; -+)/$& "0246&$" 2064%'!#1357'%#!3175.(*, : <>8,*(.8> < :/)+- ; =? 9-+)/ 9? = ; "$&4602" &$6420!#%'5713#!'%7531>8: < *,.(< : 8>(.,*?9 ; = +-/)= ; 9 ?)/-+ "$&4602" &$6420!#%'5713#!'%7531*,.(>8 : <(.,* < :8>+-/)? 9 ; =)/-+ = ; 9?v`w xx xxy`z {{||)Bc_.%]P4BB4P]%._cB)*Bbc4JxsRAQBP]y3/pp1(\cB)*Baf; 6[u{^RmbnY<#YdA(*B_jB!=J=EBr,k2ADGWdA'+A^oI$ &4 _g0RUd@'+A\|sQ0"sA7~ y}2z[Td@&+@ZxxY=(*W^57~f >HP. odRc?% +?Xt~bJ;:P@ $f}zDdlRb>$ *>VpkXNUvlW)(D |*`&`Y[s Qa<" *=Sktebq~? |8HlRy Q`;! *<Qg{~sv]*t{-{NKi,1~J R_:  ):Nbs}|j=^G5pz1 CFGD! S]8 (9K]kqkR }Txx' m&`>" T[6 (7HWbeZ:5p_2 gw T bx 9" UY4 '5ERZXH"Za ! JyvU# t6" WW2 &4ALQL6 7)ZLb Au%e kF3 ZT0 %2>FH?%5 Z"/ Js( 1]R. $0:A?2P{4=y frB+b W1`O+#-6;6%k\  V }p-' {51d}L)"+24-/=H n0WF 5M3hyH&!)/.$ C1lPc6EX +mN3 as6luE# &*(W}RG; $ -k5 urg: $qqA $&"&kfr"d4 Bi8k.^_?{)vl= !" 5~QIGg`;rRLLYDt0{g9C;MzE8:e> (e>WKm6b5 R&tyI}3c@>Ly3VTe=\1 '`z2{Ot`cC,Y]\EW,  1mjHc,U^F:*_gRMQ(  ;{[]Lf4 )cp\H+grHVJ#  EMq64LP ,YZ=Kj1r~<_}D !O>"J4j(K`WM;{0 ht=  )Y1_Bpd$vNUWP&Hk#rk7  0b|$s XZy*RR*yZX s$|b0  7kr#kH&WPNUv$dpB_1Y)  =th 0{;MW`K(j4J">O! D}_<~r1j=KZY, PL46qME  #JVHrg+Hp\c) 4fL][{;  (QMRg_*:F^U,cHjm1  ,WE\]Y,cC`tO{2z`' 1\=eTV3yL>@c3}Iyt&R 5b6mKW>e( >:e8EzM;C9g{0tDYLLRr`;GgIQ~5 "! =lv){?_^.k8Bi 4d"rfk&"&$ Aqq$ :gru 5-k $ ;GR}W(*& #Eul6sa N3m+X E6cPl1C $./)!&Hyh3M5F W0n H=/-42+")L}d15{ '-}pV  \k%6;6-#+O`1Wb B+rf y=4{P2?A:0$ .R]1 (sJ/ "Z 5%?HF>2% 0TZ 3Fke %uA bLZ)7 6LQLA4& 2WW "6t U#yvJ ! aZ"HXZRE5' 4YU "9 xb T wg2 _p5:ZebWH7( 6[T ">`&m 'xxT} Rkqk]K9( 8]S !DGFC1 zp5G^=j|}sbN:)  :_R J~1,iKN{-{t*]vs~{gQ<* !;`Q yRlH8| ?~qbetkS=* "<aQ s[Y`&`*| D()WlvUNXkpV>* $>bRldDz}f$ @P:;Jb~tX?+ %?cRdo .PH> f7~5^W*(=YxxZ@+&@dT[z2}y ~7As"0Qs|\A+'@dUR0g_ 4& $Io^A+'AdWGDA2k,rBE=J=!Bj_B*(AdY#<YnbmR^{u[6  ;faB*)Bc\(1pp/3y]PBQARsxJ4cbB*)Bc_.%]P4BB4P]%._cB)AGERE PCMLL V2.1.37.105, seed = 1220, 2/1/2004@,L|,L|,L|,L| |  |  |  |  | |=|<|<0P0P0P0P` ` ` ` ` ` `` @@@ ,Ll ,Ll\\\\<< < < < < <<0Pp0Pp ` ` ` `@@ @ @ @ @ @@<\|<\<|<|<|<|| | | | | |||||||||||||||| @` @`@@@@  @ @@AA A0A@APA`ApAAAAAAAAABB B0B@BPB`B sDA KA\A LA S3A@ڨA@^VA@\AAXA=AHAeAkAÅAhAGA~A{{A~xAuAssAVqAnAȊkAhAeA{cAReaAD_A[AdXA~NAjAzAA>(wA!A"A|A 8 AAƁA04AϋAɈAAAhjA@GA{AxA %vAsA0qAZoAkAhA2fAcAơaAm_A\A@XA(8HXhx(8HXhx0Pp0Pp ` ` ` `@@ @ @ @ @ @@!#%')+-/13579;=?BFJNRVZ^bfjnrvz~ (08@HPX`hpx$4DTdt ,Ll ,Ll\\\\<< < < < < <<| |"|$|&|(|*|,|.|0|2|4|6|8|:|<|>|A|E|I|M|Q|U|Y|]|a|e|i|m|q|u|y|} 0@P`p 0@P`p @` @`@@@@  @ "$&(*,.02468:<>@DHLPTX\`dhlptx| $,4<DLT\dlt~ ,<L\l<\|<\<|<|<|<|| | | | | |||||||||||||||||!|#|%|'|)|+|-|/|1|3|5|7|9|;|=?|C|G|K|O|S|W|[|_|c|g|k|o|s|w|{ !"#$%&'()*+,.0123456789:;<=>@ABCDEFGHIJKLMNOQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !!""##$%&'()*+,-./001123456789:;<=>?@@ABCDEFGHIJKLMNOOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@?  ~7ik~T0  ?qg9~ ? \20^==lC~-JK$ A~V}Y~AG xc0"P,r} V|;(^zR9mYo| e5G .mc);|*\8X=T 4|P*ux{is^" 9;kzck& ?(*k*nyh6%Ru* CEJM2 xFsp A0 I\(y c{woj7t!24 Nuv5g N@vx?V8"9 Rz@ Ot Of7M= Vs `n `s6# bA Zm r%& UewC ^g: rp(;3 5G `a~\n n0+W W~K e\iyYO%i j m-x3 OxP gXT5 9 Xc qEi4D0^@W }*Te qEg8 UI\|CCO| Rg qCe=bXGZ$F>'(tNi qCc?h^WH3.oLk qCc?jZ6zU`KZF4kJm qCc?hMiSMW:gGo oEe=b6PP6b=eEo oGg:WMSiMh?cCq mJk4FZ`KzU6Zj?cCq kLo.3HW^h?cCq iNt('>$FGZXb=eCq gR |OC|C\IU 8gEq eT*} W@^0D4iEq cX 9 >a. / .mGo `\J P m;Ac`%tJo \a[Bf) Q8Ze@"zLm Zgpsc6l 6`giq1 Pk VkX L3WibATi Tq8 0J%U_+0%C6Kx+1I }+8K]`.I ~+ +N5Ki#BI(I ~+ {; s'Hx+'K[hbj,K'pj (K"pI {+'p" vI +# z; rHy+KKc'qKckJk C c kKZ`"qI z+'q" wG p@p@@ p p@`@ 8p`6# IKa#Ka#O`I`Kx+#K`{`#Hr H`x` #Hr#I`'Ipq# v w 0pq t uKIp #I pK[h++ KX`G@@@ p pp p$p@-S/@-M/HxD[@pXp//ApYpXiKx+"gK`gI x+ fKhfHzB'vdKx+cK]h0# s |+# s" t]K]h# st"VI pUI y+HXKhTHz@BA'w" qPKx+d"QKZ`0# r }+$ LKX`# r u@"IKZ`# ruGKh#@*EJ!Q^#CBJ!Q^#[B@>J%U_+0%C6Kx+1I }+8K]`.I ~+ +N5Ki#BI(I ~+ {; s'Hx+'K[hbj,K'pj (K"pI {+'p" vI +# z; rHy+KKc'qKckJk C c kKZ`"qI z+'q" wG p@p@@ p p@`@ 8p`6# IKa#Ka#O`I`Kx+#K`{`#Hr H`x` #Hr#I`'Ipq# v w 0pq t uKIp #I pK[h++ KX`G@@@ p pp p$p@-S/@-M/HxD@pxxJp//pYp𵁰$Jx+ЛH|+ }+ x+!K`K`#p#J`I ~+#^++EяI#^+#^Z<(<"RBB<#[BI#^+#^Z ( "RBB #[BzIyI#^+xJh #C`# tJh #[B@`# oI#^#^+ #^+iJh #C`# #dI`KhdKxB"\HtbI x)aK^h0#q z+"q#rZK^h#qr#SI vRI +pNKhQKx@Bh"GHu# wLI x)d#LIK`0#p{)$"GIJ`"ps@#DIK`#ps;Jh- #`?J8IKh$ , 5I h@"BcK`c$ ,#-IK`3Jh"@)#/J -J ?##@,J`h#['JJ`%J&_60#CI x)H{)!K^`H|+}+|H|+IJi#@#B@y;q~+*K[h IKdJlK"v' pp@@@ @p0(p p@` 8p`!IJl !K#v Hy+"I v#tH}+*Ji"B%x;p+KId"wK I e ml Cdl KZ`#wHx+"I w#uGpp`!D#+HCa#Ca)Kx+ (KX`(KX` 'Kp'#K_`#K_` #Kp K` !O8v8w ; 3tuvwrs Kp" KpCh "@@O;hC;` O8`x` HCh ;+[D' HG`G p@ @@(pp p$p@-/@-/HxD@p@pG-1 Ƞ,x,ʏp Y*"Z W W @1L<1H Ƞ,1X*"WX 0J00 7P W X0P|0*" ς ςlPd} TD0<00/$p p͈ p8 pHpLpDpPp D\LocationSoftware\MicroSoft\Windows\CurrentVersion\Telephony\Locationsb PuRj0Qp000F000F00F0Q 1A0Q`@Ο x9 p9ta0xr8@0`36x`3b!p!PiPdq`Q`3 e@PPp?Q`1Q@`1QEq.5 PI00nII0.IdI0Tn0QP` x`PapPP"IyQΙΙ1QΟX0xšQؠX`ΟP0 Px?u`1`PQQЀPvP13`P"pP!PK&xtsy?Ι`1@&`0xPxp9T``@ΟPt?ΙPt9qeQԠPt?qP~x9ΟrQ@`3l i{iQ@`3 Q`3 il(q@{# K"Jkx?0QPPPPuu9ΟP00`3ЛPPPvu9ΟP00NY`1`Pu`P"pP!P! x!`PPՙ0aqya~pp`0P PPL 't!nPPPuΝP00`3Лt?P PPTAa`31 Px9  P~PPegx@Ο(P PlX`@005Pt9.  Px` Pwy9.Sp9qSp9 q`x9q` PX` PnX`S Px9. X`p9 qzP2 S P3t` P2 S PQ8P<0Ћ PdPuP<0КtP<0О `1ЫP@rw`w`w`w`SP3t9 P2x?ΙиΟS Pp?Ιx?Q. x?t`T`SP2p?qPnp=. P`Pt9ΟSPp9. P"PQ@u?p@0qs`V,ppSP2p?Q PnP`PPp?Q`1Q@`1QEq.5U` PI00nII0IdI0SΝP! xpP!0QPIyQ`X0QPZȄ`46 tx?1z?i?mЧ1zhN15Nǭt`0Q`@0QPLqt? PhPLuPPӰPPPuPD@0p9Ptn PΟQp? Pwx?. Px3 Pa`Pt?PPaPPv?PPav?PPap9ǎP PP`P`r?r1Pt?PPap9ŎP PaxPp9 q(oPp?Ιk PPBx9t`3tPt9qhPt?Ιh Px?.q(hx?ΙP` PAX` PX`Pt?q PAx?.qX`T`Pu`t`Ppu`PAu`U`u`u`U`u`T`˒FKNY}bR}cR}mR}nR}dR}eR}oR}fR}gR}hR}iR}jR}kR}lRQP}`R}aRY}NAE[N^JDbNe^Λ݀D݀D݀ E݀݀D݀pD݀FΝvFqбqqБqЮS݀vـpHـHـIـ IـHـHـΝـ0KـHУFЦF@MЪFPбBـH Qйи1z.йJvBـH QbѸ1.JvFJJ`+ / 6 0 1 7x 678lmH@,@ P ()*+./012367߃߄+Ԇ1߆PEPIDZxÌ7xÄxU|xEPIDZx7xRp0R0Q8Q<1S00RQѠQ#РcxiPQPdRP`b<Ι0QԸx@7X<0ox<x@7XaظHz1xxqظŰaHzp183..Si-Ԡ <XxHzp1<ΙQР<Rp0J0x0``<Ι#aW&fx#x[dxÏ<0PU(P@ҊVgxUx[exÈQР<1QРѠРV)UhxQР<Ը`1aظ5 -DZ7PY@X0Q`5<.Q`1t)QҠ1H8xlx6x***0Q`n(x8(xÅ0 # `_ <xSq$z%b=x)x*xx]8`5иF@1hmxQ Q`R>P@3&`R>p0R0p0R>p0R0PQx0PQ&`R?PÂp0PÂp0Pî0S &` S?<Zp0J0<Zp0J0 S0xRp0J0Q5Q`RP@3`RPÄp0RPSJPY.JPî0S7 . LRPÄ` S<Zp0J0.x_8:xÈx_ S9İ@0]0xNaxqxx_8Sy`QAzRxPpuxp`00  R`' !# +[Zqp`c8t6eo].1J,i}d WJ'_'_>gb1tK(C_< `0Q@PA 7DQa1j 0Q`AQ`Q`Q`Rrt00000000z`HxRPQC-QRpp0bp0qF14< QРf'ٸРiٸРnظР3<` @PQx^a.`0,x0\y 08`-X\ 8ux~ `< a 9~ ΛsѸ°@04 <8 ʼn< <ΙН<Ι~Q<`1Р`3РQ`Р8< <|8 IQ9@0YQf@0I<`1ЅР`3РP`8`3Х< РP`8< < m?va0Q"88@0nY4Ξ20`Q㋖x3PPT``X SS - S< S < - SS `Eq PQ/- S! S S` ` PQ/ S}`Q Zp0J0.`ZPPQS1 / `P PQP/7xÕxG< S>`QP(QԠNQԠ=QhԠ9U`T`=T`0x-SQq<`1SQq<`1_qЛ N p/? x@ZZFB()*+,-./8012׀ 3456\789f:R;d<=>?678lmnoxRyzKL#MN$O7PQR$ijk hߑacdefg{/Ԃ9?@ABCDEGH0J?KL0@AB.CDAEkFfg)hpt?6785lmnoxRyzKL#MN$O7PQR$ijk bhߑacdefg 0x_eEu!),~90  T<P8\P@0S@I_Ը@0 P|S``(Pda0Q"88@0nY4Ξ20-  O} =<QРP? SPCAzp. ˅QG<1 S>`QPP@)PD8.= P>и-Ss<Ι`1Ο=8Ο PDи`3S-r<PC@zpP@<<`P?<=)=QG<18ΟP W'!0P 0QQ8PRRRRp0R0Rp0R0Rp0R0Rp0R0Rp0Bp0BcSRp0J0Rp0R0Rp0R0Rp0R0Rp0R0Q8рp<`Rp0Bp0BQP QRpp0bp0qF1P& <Q`1Q1HP$ <Ҹ1H8Ҹ7 P$ <ָ1 H<P% <Ҹ1H0x`S00RP QѠQ#РPRsp0Jp0Jp0PDJ`S#P <Ι8[K [p00xP@0XFKNY}bR}cR}mR}nR}dR}eR}oR}fR}gR}hR}iR}jR}kR}lRQP}`R}aRY}NAE[N^JDbNe^Λ݀D݀D݀ E݀݀D݀pD݀FΝvFqбqqБqЮS݀vـpHـHـIـ IـHـHـΝـ0KـHУFЦF@MЪFPбBـH Qйи1z.йJvBـH QbѸ1.JvFJJ`+ / 6 0 1 7x 678lmH@,@ P ()*+./012367+Ԇ1߆PEPIDZxÌ7xÄxU|xEPIDZx7xRp0R0Q8Q<1S00RQѠQ#РcxiPQPdRP`b<Ι0QԸx@7X<0ox<x@7XaظHz1xxqظŰaHzp183..Si-Ԡ <XxHzp1<ΙQР<Rp0J0x0``<Ι#aW&fx#x[dxÏ<0PU(P@VgxUx[exÈQР<1QРѠРV)UhxQР<Ը`1aظ5 -DZ7PY@X0Q`5<.Q`1t)Q1H8xlx6x***0Q`n(x8(xÅ0 # `_ <xSq$z%b=x)x*xx]8`5иF@1hmxQ Q`R>P@3&`R>p0R0p0R>p0R0PQx0PQ&`R?PÂp0PÂp0Pî0S &` S?<Zp0J0<Zp0J0 S0xRp0J0Q5Q`RP@3`RPÄp0RPSJPY.JPî0S7 . LRPÄ` S<Zp0J0.x_8:xÈx_ S9İ@0]0xNaxqxx_8Sy`QAzRxPpuxp`00  R`' !# +[Zqp`c8t6eo].1J,i}d WJ'_'_>gb1tK(C_< `0Q@PA 7DQa1j 0Q`AQ`Q`Q`Rrt00000000z`HxRPQC-QRpp0bp0qF14< QРf'ٸРiٸРnظР3<` @PQx^a.`0,x0\y 08`-X\ 8ux~ `< a 9~ ΛsѸ°@04 <8 ʼn< <ΙН<Ι~Q<`1Р`3РQ`Р8< <|8 IQ9@0YQf@0I<`1ЅР`3РP`8`3Х< РP`8< < m?va0Q"88@0nY4Ξ20`Q㋖x3PPT``X SS - S< S < - SS `Eq PQ/- S! S S` ` PQ/ S}`Q Zp0J0.`ZPPQS1 / `P PQP/ 7xÕxG< S>`QP (Q ԠNQԠ=Qh Ԡ9U`T`=T`0x-SQq<`1SQq<`1_qЛ Ngb1tK(C_<R' !# +[Zqpac8t6eo].1J,i}e WJ%^&_=>L5(6c8$\Rf&& ! 0UI j m8M!?FXZ,Q.Gw9h)D I:7@DE's{k!bH<,D,@y1 n.O}f ! &&0UI j m8M!?FXZ,Q.Gw9h)D I:7@DE's{k!bH@*iARNPRh #/L?X -7'X5w(%0ifI!dMO `'l (LjjWگ%~0yBgfk)vl3dv4cw$/wh  :50r{=iJ$ *+vwl67.? q/S'pYp< 31 l V5ًb;?+<9o$4NHfh *#<ZB ~PK[ /hr.NEZ ? Ql,M1 =u9P-=rH%dِ9u.H_DXW;LvMPf~j  7+Vo@hA\f}ZE w\'&ir/4|.Xx'ddXeI  O"D +Nݙj~9?r@M ZVh~j  , D\<~s=Z*b$zBzdqkatvsh}'jN  n{74!ؽ`9~rE $(Xyqlf&\r*1R?  &MP7P3_w2!ly5{}?jOb;}l 2u/Y<n 2c~޵ؿy!V}BPHs~{C.b{z  )7Wf0}>P!f HT%H4:qUfq3w|jkz3y-5 a l  M=HؓiDyZ^KEu}8K Xz  4;.hg"ry`1H<qKnb=`+B}!{rZTy-<^ "(qjJלzQY7dwe p0hEDnqz|& !*DJ 7}},Z^fJYo`$s?3bs ys@L~+vqfElL b6 -~bؼ31V}FV%O zK6j~ -.*TMR@[2V|w+kg1I/X"s s|1Ys?]b 'U  5-ݧp861P YfV1k^ #% *VS\?oE~zEq'Qi#@.E w 0fئ{~`C+)oRrd4g%`~   #4#OX'J6V ' Y@b##z0XC,m~tm?w{~<>~ml p/? x@ZZEW0x_eEu!),~90  T<P8\P@0S@I_Ը@0 P| S``(Pda0Q"88@0nY4Ξ20-  O} =<QРP? SPCAzp. ˅QG<1 S>`QP P@)PD8.= P>и-Ss<Ι`1Ο=8Ο PDи`3S-r<PC@zpP@<<`P?<=)=QG<18ΟP (Q ԠP ԸNԠP!?678lmnoxRyzKL#MN$O7PQR$ijk hacdefg{/9?@ABCDEGH0J?KL0@AB.CDAEk Ffg)hpt?6785lmnoxRyzKL#MN$O7PQR$ijk bhacdefgr^4P8P/DDoq0- oP`8q- 00PQ +Q`RP@3o` SPž`RPÂp0PÂp0RPž` SRp0Z0RPRp0Z00Rp0J00Rp0J00x؛()*+,-./- 0 1 2 3456T 7 89f:C ;U <=>?6785lmnoxRyzKLMNO,PQRijk bhacKd9e3f&g){/9?@ABCDEGH0IJ?KL0@AB.CDAEk Ffg)hpt?6785lmnoxRyzKLMNO,PQRijk bhacKd9e3f&g)Ā; G^SR@ RpRpS`SQ|QPQQQ=0RQF@1 0 P<8PQQIQF@1 QY `SAP$PPP`Pdr<Qo1Rp0J0r<Q1Rp0J0P<Q R00RP`QՠP_QXԠPfQ}Ԡ(BP`P5< P@XRQ0F00F@1& R*00F00F00R+00B00B00 P<QT @@PxP<Q @XP< PQk P8R*000Z000R+00Z@@`P^xP7P_x0x 710?0000000000000000000000000000000w, [ ;`T/1& PԸP5 Pbr<10SP5Qq<`1P5QpP P8и `31 q< PPyQՠՠԠ\ q< Py8q\ P8Q\ PԸP5q<1P``<QaP<QiP`xP5 Pbq<Py<Ι Pz<Ι PPP`P5<q8P P| ʋPP5ʋNP88PָP8`1  Ը`1Pи-1ћIP@0P8Q P08Px>a0Q"88@0nY4Ξ200xPP6``04 ><PpQ`0QPPtp``00P<S8PzSSP`P<qP`SP_Q(BԠ`0xP<SPPySSKP``P@:P`0xPd`SRH R`SApSpRQ|QS S]F00000`P@P_ S`QP`P^xP7P_x?g\"> p/? x@ZZy``P=pPm P5P&x`QPpehu0yy= ` P8P`xP `PnpPP' P5xPpekuՠ`P `P8uP8PaxP 0x`P< P^xP5q$z%bP_x`P=pPmP P5P&xpehu0yqy=`P<8<qy, qܘ, q, qC ȰԸ@0IȰ@06 PȰQ @0IȰ@06P`x`PnpPP' P5fuPaxP;8x0x]]]]P$xxpehu0`P; P< `P)pP4P( P5`QPxPpuPp`00.. `ET4\TLnC 33'1h<%o72<BJQX`gov}{n`N:$ ^2`#Zs rZ-<.1Q1IPQ`PD0x`X SS]FjC SE]S]E]]j SS]`Eq? PQlj  S!H S S`]`FPQl S[`QF0xZp0J0.`ZPXNPQSn l `.7 M8J` 77 8AX'Q0xQ0xnXJ$c%`Q w<ΙPdQ|ؠPvPиP$Р0xPd`<Ι~<Sq6 P<PMظP j<.`1<Q`1x<Sq` P< P$< PPظP j<.`1<Q1X`X`X`X`<Sq P< P$< PPظP j<.`1PjX` P<Q(B|ؠ0x` S`QP`PFPQPlP@PP_P< S`QPP`QaԠPQԠP_QԠPU`T`PT`P PP(BT`0x-P5Qq<`1P5Qq<`1_q4P<qP8q P5P<<s8U`-P<P5pU`PypQ`P^PPQ`PPQ`PPQ`PP(BQ`P$PPP``P80xP<PP<PP<nP8Ο{PP`QzԠPQԠP<P|P8QPԸ1P J)< m?&1Le{sM\94Vm7yf y}y fy7mV49\Ms{eL1&r  0x`PP PP(BP` SSP]PC S `QPPP P`P`SP`P`CQР P PٸРP ٸРP ظР)P p` Uj{08``Pr pP P -X\P- P!8 P ` P, < P| x P ΛP Ѹ°@04 P <P 8 P% < P <ΙP <ΙQ<`1`3P Q`РP 8P) < P' <P 8 IQ9@0YQf@0I<`1`3P P`P# 8`3< РP P`P 8P' < P# <PP <P @00P xpa`q4`P P58 P P!<Ι7;<Ο*Ι5i.Ι5m5 S M8M 0<A q(MP < 0 `P pP P -X\P- P 8xpa`q4` P YQ @0P -иqи0P! `P 8 P<.PиP `38. Aи`1Ȃ<T`Ι<.:8 NRPXN Rp0Z` PA<Ը`1@Ը`1 P`CиP<`1РP+ <Q`1:<Q1)P P pP <P P) P`C8 P<mH P <Q`1H8 P P P <P и`18 P P <-)8 P <7QԠHQԠQ@ؠ:<Q 1P* <(BPI#`P5< PJ#@XRQ0F00F@1VR*00F00F00R+00B00B00 P<Q@@PPI#xPP<Q @X PJ#Q PK#8R*000Z000R+00Z@@>a0Q PQP#)иQUb@0-0S66 Y-A@N 0`10xPPPQ`PPP`<P>`bRx0`axqx0 xPԸبPԠP;Ԡ!`00 zx`P8Q`1`R;`S1HPaP`PbRՉQP<ՉaIωaωaPz0xBQ BQ `>a0QP@0P< 8 YAP; P 0xP;80=yx@`PnpPP' P;P$xxpehu0ՠ P; PΝ`%o72<BJQX`gov}{n`N:$ ^2`#Zs rZ-<l g V 4 # i  # 0000000000`e(B(B(B0<H(v (BA `P|q a{pQPQPDP"RP_N0x`P(<ΙP(ԸP*@7X<0<P*@7X P(ظ11PP*qadpcP(83P..iz-ԠP( S*XpP(<ΙQРP(<P(Rp0J01P(P(x0`1`P(<Ι1P(P(RP_NQ  PQP*@X̉P(QРP(x0`P PP( RP_NQ  PQP*@XP(x0` QP(РP(ѠРP( ) QP(Р1P(<Ը`10Q`{<.Q`1 )Q-)1 Hx~x4|x1 B(B(B(B(B(B(B B(B(B(B(B(B(B B(B(B(B(B(B0Q`8P (<ΙP Ps8 P`<xqs x<Ιs <qq Pqzp PqKp PP P P (<Ι Pt PPj`P< P^xP5q$z%bP_x FxP;81`PmиF@1 P1`Rp0R0p0Rp0R0PQRP_N 0x`RPbNp0P[Np0RPbN 1` S<Zp0J0<Zp0J0 0x`Q w<ΙPdQ9P (<Ι QP<P$|ؠ0xPdPw&P&qSxU`P (<Ι8 P&QxQ`PP(BQ`P`0Q`<Ιp <ΙG  <Q`1j <ΙY  <Q1) ) <Ιv  Pj)Q(B|ؠ `ԸP j<.`1 ` P`8q S P0 P< ` P`8q )Rp0J00xP< SPzSSP``P<q P`SP_Q(BԠP P< S PySSKP`&@fh>&&&'`P&axqxx P5Pw&x0Qpehu0yqy=0Q Pw&`P`8q. P<8 P&xx P< P5P@0P; P&axqxxP<8 P5`QPx&xPpuPp`00 R Px&`P5PiPy&Шp``01000' !# +[Zqp`c8t6eo].1J,i}d WJ'_'_>gb1tK(C_<7;,,Agere SoftModem2.1.80.0GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3)GCC: (GNU) 4.1.1 20060612 (Everest 4.1.1-3).symtab.strtab.shstrtab.rel.text.rel.rodata.rodata.cst4.rodata.str1.1.rodata.str1.4.rel.data.bss.comment.note.GNU-stack@c  к5)`c iq % `1>29M21`@R4 \ sfuB kuBt̷̷yP X[oF F )F 6F CF SF pF F F F F F F @F SF tF F  F AF :% JF \lF ~ F  F  F  F 5F F F F F F cF j tF }F F DF F F F F DF *F GM [F xvF - I F   F  F  * !F ,N3KF ]m. uF F F  F (6l derF F DF F F F F F F F  F  F  F $5)F 2F ;F DF MF YF eF vx {  F x F F F F F 'F 6F EF ej zF F F F F F F F  F F 5 F  F $ F ' 1 [ c  v  F              &  2  <  n   F 3 I F y F M L F  F  F D F D F + F : F D  I F S X F m r F  F F F F F F  F ! F 2 F u F F F F  F :YF eF }~ F F F F Y^F oF {F _ $F <F P~ dF F F C F 8GF \ hpF  F F  F F LF iF  F F BF F F BF -3F [ xF F F F F F FOF \ bF tF F F F F F  F  F ,F 5F 4F [fo tF  F F F F  F  F  F 5F ,F #(F 1F IF RF Y ^F e jF q5vF  F 5F F  F  F  F 5F x ' 2F 9HF OFaF ~F  F 5F l l  F x  F  F  %F BGF N SF Z5lF {l l F x  F F  F 9>F {F  F F F  F  F  F 5F 5 0;=F DpIF PZ UF \nF F  F  F  F 5F F F x  F pF "'F .AF ]zF  F  F  F 5F F F x /DYnF } q F F F  F  F 4 F 5F F QF X e sF F  F 5F F F x /DYnF } F F F F  F F F  F  F < F = BF I):F  F 5F   F  ,A F F M  R F Y 5^ F  F , F  F  F 5 F  F  F ~! !F ! !F !)!F !,!!F ! !F !5! "F ","F ;"@"F `"e"F l" q"F x"E }"F """"l" "F "#F 3#;#F g#o#F #F ##N#F ##F 3$?$F t$ {$F $$F $[ $F $$F $F $F %%F "% '%F .% 3%F :% ?%F F%5L%F %2 %F %%F % %F %1%F %%F %%F %%F & &F &&F & "&F E& J&F }&&F &F &&F &F &5 &F 'e'F 'F ''='F E'F L'X'ef'F x'F ''F 'F ''F ''F 'F '(F (F (,(7(F I(F d(F |((U(F ( (F ( (F ((F (F ((( )F ')8) @)F b))F )F ))N). )F **jL*m*u*F *j***F *F +F +F + +F )+`5+F Q+F a+F q+F +F +F ++,,E-T->..j .j / / 3a>> > ? ? ? @V@BwHF HF HF HF HF HF HF HF IF IF #IF 2IF AIF OIF ]IF kIF {IF IF IF IF IF IF IF Ie>JJF JF JF JF JF KF KF ,KF ;KF IKF [KF jKF yKF KF KF KF KF KF KF KF KF LL/NNP_ P_ 7TU1"U1X+ X1Z1[+ d trF rF rF rF rF sF sF TsF sF sF sF sF tF &tF 8tF PthtF tF tF ttttuz!utGuF SuF ku uF uF u5vF v vF v &vT+vF 5v :vF DvOvF _vqv vF v vF vFvF v6vF vq w wF w wF )wF.wF 8w6CwF Kwqww|wF w wF w wF w wF wqwr wF x xF xlxF "x *xF zF bzF zF zF zF zF {F '{ a{ f{F p{{F { {F { {F {y| :| ?|F I| N|F ^|F | | | | | } } }F &}tJ} P, F 'F 4F NL_F F ‚ǂF F 49F nsF F F F F F !F 0F SF nLF Ȅ] F ",(F >FF ^,dF zF ,F F օ,݅F ,F &,F <F NF `F rF qqdžF ՆF F F F F 9F LF YF F ̇F ڇ j F %F *DHF ]cF tF F  F F ̈шF  F F ntF F  % ͉\ ى߉F cF v; F  F Ί ڊYF r 0F &*-F 7>F H*YF q wF F ˋ ܋F h F F *(F @ EF V_ \F tF  _ ŌF ތF F 5:F [g_ oF F F ߍiF _ F 2F ^F 4F _ ÎF ܎F F Qr~_ F F ˏF  F (_ 0F IF uF  F ɐՐ_ ݐF F "F M]RF s_ F F ̑F F )_ 1F JF vF  F ǒӒ_ ےF F F AF ] oF h F F F F ̓F ۓF F F F F &F 5F DF SF bF qF F F F F F ˔F F F F F F %F 1F =F NF afF wF F F  F (F 4F PF wF F F F F F ĖF ЖF ܖF F F -2F <QVF `nsF }F F ͗F ',F 6^ CF kpF zF F ʘϘF ٘F _F #+0F :^ KF `F |F F ̙F F &F GMF afF F F F š_ϚF F  F >MF zF F F ÛF ԛ_F _!F AFF PUF dF *0F DIF w|F F ȝF _F MqvF F ڞߞF #(F 2TlqF {F ş_ʟF F F F EJF T^ wѠ֠F F #F :F O[`F j^ }_F F ^ ݡF _F F $05F ?^ fkF uF _F F ΢ڢߢF ^ F #8=F GY^F ho_tF F F ȣ F 0 #/ ;F GF `F F ֤F   *F CF TF iF }F F F F ٥F  F Zk_ qF F ĦF F F F *F FF YF F ͧF EF \F kF F F F ܨF F F $F 7F DF `F F F F ԩ کF  F ?EF êF ΪF h F DF 9>F IF SaXF gF vF F F F F ̫F F F  F F F 2F < H QF `F qF F F F F ¬ǬF ԬF ެ F F F F (-F 8F GF WF F F F ǭF խF F F F F F (F 7F FF UF    )7GF aF F ߯F F ;]cF }F F F F ӰF F F .F uF F ±F ۱F :?F JF bF F  ѲF h F !F -2F =F GV[F glF wF F F F F ųʳF  F F F F 2F EJF V[F fF p{F F F F ŴF ѴִF F F  F F #F 1F ?F  7׵F F F F F F &F LF eF sF F F ŶF ӶF ߶F F F HF VF hF F F ÷~Ϸq ۷&Q~F q F #&/Q@F N Vt^sF F B¸F ݸBF B  !P&F 5F DF SF z~F BPF ¹ ǹF ݹ F F   F F 2F G^F lqF F   Tɺi κӺ]F F F $ 3jBF WF bF w F F   F ʻ ϻF ޻xF F F F )F 5F AF MF YF eF qF }F F F F BżF i  F F  "F 3F HF g u F F F F F F 'F ?LF nF  F F BPF F F F +F :?L K _dF nsF F F ÿ ȿF ҿ߿F F >CF RF ejF yF F F F F F F 7BC OTF ^#cF rF F F PF F d F PF F <Ad NF chF F  F F  F F F -F <F FKF bF  F  F  F F  F #F ;F b y  F F F F  #F >F LQF [`F wF F F F F F F F %*F 9F ^sPF F d F F F !B5AFF PUF lF F F F B F #P(F 27F FF aBhx( F F F F k F F  F &(4:9L EJF TYF pF F F F ' F F .2 3F =JF oF > F F F  F (F LF B F F  F F F F F  "F ,9F Hq MF \ h> t~QF  F  F F F   F *6PCF \F    F F  F %1P?F y  F F  F PF F  F /F FA OF bF zF F A F F F  F %F 6F MF ejA pF F F F F  F  F 'F BF Pk \aF kpF A F F F F  A F -F PF ^k cF mF  F F  F F F F  F /4F KF chF F F F F F ,1F ;@F XF F  F F F F F F 3F Y^F hmF ~F F F F F   F F / 6{F F F F F F &+F :F PF dF F F F "F 8F UZF nF F F F F F F !F BF F F F .F =F YF F F F 6nBF ^n|F F F &F 05F ?DF F F F UF `F F F F F !VF iqF F F #F 4U=F v~F F UF W F F %*F >F [F ejF tyF F F F F F  F ,F EF e lF F F F F F F ,F 6CF _  F F F  F F )F 8F IF XF iF xF F F F &F 5F DF VF mF |F F F F F F F F .F YF ~Q F _ F |F AF 90?F e |F mF  F  F F F +F 5:F IF ^cpuF F  F F F F F F L F %F <F OF bF rF F F F Yv kF }F F F F F cF UUF F F F F F F ,F cF IF F ' DF SF pF F F & F  F F & F F F F ).F 8=F NF ]F glF v}F F F F F F F F F aF F BF sF n F F F F (F #F 1 NF \F jF F F F  $_ 1F hF F F F F )F mF  F F $ )F 5F YnF F F F F KF F F F +F :F HF WF fF uF F F F F F F F F F F +F CF [ wF F F F F ) 5F tF FF F F  &F ^v jF F F F F F F 5F LF hF wF F F F 9F fF F F F F @F bnF  :17B  : 1; BpIPE d p x   F h} u)F DF iF szF F F F F F F F F F F F 'F 5F CF WF kF {F F F  F "F BF F (F >\dx    F %*F 49F sxF BF BF B F F F 49F ]BbF BF B F F F F +F @F NSF mrF F F F F   F F %*F 9F TF rF F  F F F F F 9>F MF YF pO F F F F F B F   F $ ) F 3 8 F G F ^ F w F   F  F F F   s B& 7 F W F l  q F {  F  F  F F F ! F S X F b g F ~ F  F  F  F F P P F    s$ 1 F R F n z >  F F   F      F ? D F S F _ F v O  F F F    F (-F 7<F KF bF zF F  F F +F 7F OF `F lF xF F F F F F F F F F F F F F $F 0F <F IF \F oF F F F F F F F (F ?F VF nF }F F F F F 0F HMF \F qF DhF ?.S.g.lF xF VF F F F .F .'V3V8F DF PF _F nF zF F F F F F F  F %F >F bF vvvvvvv/vUF nF }F F F F F F F F F F F F F F (F 4F X.]cF {=  F F F F  F F ! &F 2F >F \F { F F `HF F F  F %F 5F GF XF wF F F F F F H`HF %F 4F [F {F F F F F F F  ,S1F ;<@F Ob g{F F F F  F F F F F &F 8F FF XF fF xF F F F F F F F F F 6;F JF aF vV{F  F  H F F #(F LVQF [hF $F F HHF F  F  $# F 5 D< 2m F F h F K F F  F !F ,!1!F ;!H!F j!o!F y!! !F !F !F !!F !!F !F !A!F """F *"F 7"F I"F S"X"F o"F ""F ""F "F ""F ""F "F #F #A#F 1#=#B#F L#Q#F `#F j# v#{#F #F #F #### #F # $F $$F *$F C$F V$F i$F $$F $$F $ $F $F $F $F %F %!%F +%0%F G%F i%n%F x%%F % %F % %h%F % &h &F &*&F :&F K&F \&ah& m&F &&F &F &F &F &F &F &&F ' 'F #'('F 7'<'F F'K'F g'F 'F 'F 'F 'F 'F '`'F ''F 'F 'F (F -($[(H`(e(F o(t(F ((F (F (F ($(F ((F )F )F 6)F C)F [)F s)Hx)F ) ))F ))F )F ) )F * *F "*.*4*F G*F X*F f* ~*h*F **F * *F *X*F * *F **F + +F ++$0+F d+ij+F ~+F +F + +F + +F +h+F ,,F 0,F <,F H,F [,`,F o,F ~,F ,, ,F ,,,F ,.,F --F -F E-J- T- l-hr-F -f -F -i-F --F -h-F .F ..F !.F 9. K.F Z.H _.F i.w.F .$.F . . .h.F .i.F //F &/ +/F 9/[>/F H/M/F W/\/a/F m/F ~/H / /F //F //F /=0B0F P0U0F _0d0F 0F 000F 00 0F 0F 0F 1V1F 1F '141F G1L1F [1F w1|1F 1F 1V1V11F 1 1 1h1F 2h"2F B2hG2F V2F k2Vp2u2F 22F 2 2F 2f 2F 2F 33F 3F *3/3F ?3F e3j3F v3F 3F 33F 3F 4V4F 44F ,4F A4VF4F P4U4F a4F m4F 4 4F 4.4V4F 4F 5F %5F 45F C5F [5F n5s5F 5F 55F 5F 5V6V6V6F ?6.D6 J6F ]6f i6F u6F 6F 66F 66F 6F 6.67F 7F %7X*7F 67 ;7F Q7 V7F b7F n7F x7}7F 77F 7F 7V77F 7F 88V!8F 88i=8F I8F S8X8F b8g8F 8 8F 8F 8F 88F 8F 89 9F 99F 09F N9H \9H a9F k9p9F 9A9F 99F 9i9F 99F 99F 9F :F 9:rE:F T:H Z:F r:w:F : :F ::F :::F :G;F U;Z;F d;i;F ;F ;$; ;F ;F ;<F <i<F +<F 5<:<F R< c<F <$< <F <<F <F <X<F < <F = =F =F "='=F ?=F g=$u= {=F =F =H=F =F ==F = =F >[> >F >>F 3> D> I>F S>a>F >>F >F >F >F >F >F >F ?F ?F !?F +?0?F G?F e?Hj?F v?F ?F ?F ?F ??F ?F ?F ?V?F ?<@@ -@F R@ @@H@@F @F @@F @V@F @@F A$AF ;AH@AF OAF YA^AF AF A$AF AHAF AAF AF AHAF AF BF BBF ,BF CBF [B$pBuBF BF BBF BBF B$BF CDC2DCF XCF pChuCF CK CF C C CF CCCF CF DDH0DF HD$NDF wDH|DF DF DDF D DF D$DF DDF EF &EH+EF ME XE]EF gElEF EF EF EF EF EF EF EEF E FF .F3FF =FJFF dFF wFF FFF FF FF F FF FFF FF G-GF KGF XGF xGF GF GF GF GF G GF G Hh HF H ,Hh1HF >HF QHF cHF vH{HF HHF H HF H HHF HF IF I ,Ih1IF ;IHIF `IeIF tIzIF IF IIF I IF IIF I IF IXIF J JF "J'JF 3J AJF YJ$^JF zJJJF JF JiJF J JF K Kh!KF AKhGKF dKoKF {KF KF KF K KF K KKF KF KF LF Lf 'LF =L BLF QLF [LiL {LF LLF LLF LF LF LLLF M MF MF $M 0M5MF DMF [MF iMAnMF MMMM MF M MF MMF MF NN !NF 6NF TN aN yNhNF Nf NF NiNF NNF N.NF OOF OF 1OF IO$NOF gOHsOxO OOF O OF OF OF OOF O OF O OF PF PH %PF /P=PF UP$ZPF vP{PF PF PF PiPF PrPF /Qh4QF CQF MQRQF fQH rQ |QrQF QH Q QF QQF QQF QORF ]RbRF uRzRF RF RRF RF R$RF RQShSF Si$SF :SESF SS XSF fS[kSF uSzSF SSF SF S SSF SSF SS SF TF T-TF cTF TF TF TF #UF 8UF sUF UF UF UF UF VF @VF uVF VF VF W} WF WF HWF eW} jWF W} WF VY[YF YF YYF 6ZFZF [Z lZ ZZF ZZF ZF ZF ZZF ZF ZZF [F [[F 2[F <[A[F K[P[F _[F s[F }[[F [[F [F [F [[F [[F [F [F [\F \\F "\F 6\F @\E\F O\ T\F c\F w\F \\F \ \F \F \F \\F \\F \F \F \]F ] ]F ]F 2]:] B]%] ^V^^!_{__[_F _F __[_ _0 __F _ `F `q`F -`F X`F d`F n``F ``F ``F `F aF aF #a8aF BaIaF SamaF aF aF aF aF aF bF bF -bF gDgF igtng sgF gAgF gAgF 2hi7hF Xh ^hF hihF h hF JiiOiF ki piF iF iF iQ iF i_ iF jF +jF oF oF opF $p_ *pF CpF [p_ apF zpF ppF q qF BqF vqF qF qqF qqF rQ rF 5rF OrUrF mrF rF rh rF rh rF rh r rF sF sF ,sF ;sF JsF YsF esF qsF }sF sF sF sh sssF sF sF tF tF )tF 7tF EtF TtF gtF ztF tF tF tF tF .uy5uF EuF uF uF uF %vF lvAvU7wF DwF QwF _wUewF {wv wF wF wdwF wF xF ?xF oxF xF xxF x7yF y 3yF nyyF y7yF y yF yF zF zF ?zn GzF fz z zF zF zI zF z{F 4{9{*>{F J{F T{] Y{F c{ h{F r{ |{F {] {F { {F {F { {F {{F { {F {F { {F {|F | |F |F )| 0|F :|?|F K|F U|] Z|F d| t||S|F |F |T |F |F ||F |F | |F |F }F }q }F /}F 9}T C}F R}F \}T f}F u}F }}F }F }/ }F }F }}F }F } }F }F ~J~F ~F (~O/~F >~F H~O~F ^~F h~c p~~F ~*~ ~S~~*~ ~S~F ~F ~~F F 'F 18F BSF F _ _  m ӀF F m (m =m aF sF m m F m ˁF F F 4F `F F F ĂF F F F 1F AF SF tF F F F ڃF F JF UF aF F F F F F K kF {F F F F DžF F F h 0F D F F φF ۆF F F KF WF fF ~_ F ͇F F 9F iF xF F Lj̈F F "F KF aF yF F F މ F F DIF eQ jF _ F F >  F -F OF a_ pF F F _ F -;@F d iF F F F ÌF  F  F C 7C MF YF eF h F F F ǍF ҍF h F h F 3h 8F HF ZF lF F F ƎF ׎F F F F F F (F :F DKF U> Z_ulF F F F F ՏF F F F . GF SF F F F F F F 6 ?F gsF F ϑԑF  F  F +LRF  F F ÒF ے F F F 4F ^F mF F F ϓF F F *F :F TF tF F F ”F єF F F F F F *F 6F BF _h lF zF F F F ҕF F F IF ]F qF F F ז$F JF jxF F ̗F F $F QF bF F F ӘF ) $T 8 BYHF ^! dF Q? șF  F F ԚF oJF D4bijq. yF F F #)F HF ` eF V jF ̜ ќF F F ciF F  F ӝF F F 79MDfF tF F F F F ʞF F F F #(F =CF UF gF F F PF ̟h ߟ =- F F F 2F R dF }F {((x PuzF F F F F F ˢF ٢F F F F F %F 1F =F KF [F gF sF F F F F F ܣF F F *0F `ȤF -u9F owF F ԥ&ڥF  =BF a fF |F F F PF uF F ;@F \&bF  ŨʨF  F F $D)F 5F U`F lF {F F F F éȩF ީF F F -F <F FkF ~F F F F  F 1 6F U ZF eF vF F HF ̫F ۫F F F HF %F =F SF ]bF nF F HF ƬF ӬF F F DF HF zF F F vʭF F F 3F Lm ZF sm F m F ʮm F F $F <F FTF qF F F F ЯF F F F BGF QVF eF F F F ŰF ϰܰF  F F -F KPF {F F Ʊ˱F ڱF F F F &+F :F RF qF F F ѲF F F F (-F 7<F SF hVmF F VF F ųF ϳܳF . VF F ,F 6GF RF eoF F F F F ˴F F F F  F CO\F iF F  F F F ǵF ߵ  F (F ;@EJ VH[F gF vF F F F ƶF   F 4 :F W\VhHmF w|F F F ÷F ҷF ߷F F F  F .F =F GLF cF oF {F  F F F ƸF ҸF ޸F F  F )F 8>F OF ] uhzF F  ƹF չ ڹX߹F  F F  F &F 2F <AF KXF p vF XF  F  F ѺF ݺF  F  hF 8h=F SF }F F F λF ݻF  F [F F -F SXF oi F F F ϼF ޼F F F F '38F EF WF cF qF .VF F F ŽʽF ٽF F h#F /F >F JF VF dF qF F F F F F "F .CHF ZF fF F hF ɿF F F  F QV[F jF tF F F F F 5 Vo F F F F o F F F - LF V[F F o F F F 5F W\F hF tF F F F F F F F F F F F . 3F SF f F F HF F HF _o dF ntF F F  } F %F 8U vF F }F o F  F F 1F ;@F OF eF }F F o F F F F  1F ;@F OF cF x}} F  F  F F F  F 1 = BF WH\F jF zF F F F  F F F F *F 8F FF ZF hF vF F F F F F F F F F F F 'F 6F MF aF mF F F F F F F F &F F F MF YF  F 0F U [F ~ F F F $F 1F ~F F F } F F (( x F F F F  "F , 1F ;MF mg~F F F F 5F Kg F F F F wF F F F F F 5F ?FF PWF ahF rwF  F DF F F F D)F 5F kpF zF F F F B F F # (F 27 IF c hF wF F  F F F  F F A FF PUF _dF n{F F  F  F F F  F .F ` eF otF ~F F F %F ! F  F (-F ;MBGF ZcF }F F F F F F )F pF {F F F F F F !F 8F WF cF y ~F F F F F F F NF F F F F GF    F  D F F #F 2F <AF MF F & & #& 4& >F OF _F mF F F 4 F  F 05F ? DF N [mF F  F F F F F F F F F %F 1F =F IF XF gF vF F F F F F F + 4F KF WF oF F F F F F F F 5F ^F F F F F F F $F 8F LF _F mF {F F F F F F F F F F F F F 'F :DHF SF bF l qF {F 5 F  F  F F #IDWF cF F F F F F )F ;DIF TF ^ cF mrF |5 F  F 5C[ SF mF  F NF $ WF asmF wF  F  F F F F 'F 6F SD`F u{F F F F NND( 1F e| F F  F   b ( .F =F vD F  F F " (F nF  F F  b F F 9F Y ^F jF  F F  F   DF #F 2F CF RF aF pF F F F F F 'F 5F NF \F mF yF F F F F F F F @F NF fF F F :F lF F F F F F !F 7F LF aF vF F F F F F F F 'F ?F ZF sF F F F F F F IF F F F F F 4F UF gF F F F F F )F =F QF dF wF F F F F F F   " D0 F C De F p ^ F F  F  F F F  F ' F 1 ? F T Rg   F F F F F   ! F A F F P U F p F ~  F  F F  F  u F ;  C F T  j F y F F  F  B F  F  F , F = F N F _ F p F F  F    F F  F F 5:F kF F /  F F (.F ;^OF F F F ac F F F QF \^jF xac F F F ^F ac #F ?F [c `F n F F b6 F F F F ).F 8IF y~F F F  c F F &F MRb nc sF }F F 'F  F * /F HF aF zF EF a F c F  F c F 6F F !F 8F R^EcF mzF EF c F !F F F F F V %F 3a?EDF Yc ^F mF w|F F 2 F F EF < F  F :F DVIF mF w|F  F KF F F F F EF F -2F Gc Uc ZF fF wF EF F |F F E F F .F 8=F TF iEnF }F F EF Ec F F  +F UF h!mF yF F  F F F F |  sF $ F F F F F V F a E F   F . c 3 F = B F Q F ` F o F f  E F c F   F F F !E!F !!"!F 1!F @!F O!F `!e! q!E}!c !F !F !!F !F !!F !!F ! !F "a"c "F )"."F K"V P"F ^"aj"Ep"F "F ""c "F ""F "F "##E#c &#+#F :#F D#!I#F U#F d#F s#F #V #F #a#F #E#c #F #F $F $$F $$F 3$F B$F Z$c _$F i$6 n$F }$F $E$c $F $F $F $$F %V %F "%a(%F Y%Ee%c j%F y%F %%F %F %% %%F %V %F %a%E&c &F &F "&'&F G&]&b&F ~&F & &F &&F &F &&F & 'F '"'F .'F 8'E'F ]'Ei'c n'F }'' 'F 'F '''(F (F (V "(F 7(E<(F F(9 M(Y(E^(F h( m(F (V ( (V ( (V ) )F ()F F)F g) x) ) )F ))F )^)F **F %*F S*F [* f*F p*u *F *F *F *F + +3+8+F H+F j+<v+E{+F + +F +F +V+F ++K+E+F + +F ,F ',F >,T,Z,F , , ,F ,F ,F ,F , -F %-F A-F r-F - -F -F 2.F S._.c d.F n.!s.F .F .F .F .F .F / / !/ 3/F ^/F x/F / ///F /F // / 0F #0 )0F N0d0F 0F 0F 1F R1F s11c 1F 11F 11F 1F 1F 1F 1F 1F 1 2F (2F >2 C2F M2Z2F {2F 2 22F 2F 222F 3  3F @3 T3Y3F h3F r3~33F 3 3F 3F 33F 3F 4F 44"4F G4F R4F `4F k4F w4F 4F 4F 4F 4F #5F 25ID5F S5Ie5F t5I5F 5I5 5F 5E5c 5F )656 :6F I6F X6F b6n6s6F 66 6F 66 6F 66 6F 6F 7 7F 7F 97F F7F f7F z7 7F 7F 7F 7 7F 7F 7F 8 !8F G8M8F s8x8F 8 8F 8F 88 8F 88F 9F 69F A9 M9F 9 9i9@9F 9F 9F 9F 9:@$:F <:F F:V:F ~:F :F :F ?;F t;F ;F ;F ;;F ;F ;F &<I<_<n<F <c <F <F <<F <F <F <F =F '=F 3=>=F H=`=Ee=F {==F =F ==c ===F =>E >F >F $>G>F _> >>>F > >!>F >F >F D? I?F a??F ?F ?F ?F F@z@@@F @F #AF VAF yAF AF AF AF AF A BF BF BF BF BF BF BF BF Cw CF $CF @CICNCF eCF ~CF CF CF DF "DF 6DF EDF YDF mDF DF DEDF DDc DF DF DEEEF E*Ec /EF ZE gEF EF EF EEEF Ec EF EEF FF FF 2F EF RFF |FF F F FF FF F FF G6GF #G 2GF PGF oGvGF G^GF GGF GF GGF HHF H 'HF 9HaEHc JHF THYHF HF H HHHF H I!IF IF ,IF YI^IF mIF IF IF IIF IIF J JF .JF MJTJF aJ^pJF JJF JF Jc JF JJF KF -K OKeKjKF K K!KF KF KF KKc KF LF LbLF LF LF LF LF MF MF *MF ;MF LMF ]MF nMF MF MF MF MF NF NF 'NF ;NF ONF pNF NF NF NF NF O9OOOxO O OF OOF OF OOF PF (PE-PF DPF YPE^PF tPc yPF PPF PF PF PF PF QF 'QF IQF uQF QF QF QF RF fRF RF R RF RF ,SF VSF wSF SESF S9 SF S S SF TF *TF 8T PTdTpTEuTF TTF TF T TF TF UUU$UF 0UF 8UJUEVUc [UF jUF tUUF UUUF U U!UF VF VF 'V :VF XVF VVVVF VVF V VF VaVc VF VVF %WF DW dWF WF bF bbF bF bF bbF bF bbF bF cF cF VcF [chcF xcF }ccF cF c cF fg,gr4gF ggF ggggF g g g h hF ,h >hF hF hF hF hF iiD%iF 5iF CiF ViF eiF ziF iF iF iF iF iF iF iF iF jjF 'jF >jF WjF mjF jjjF jjk)k_kkkkkkkk lF +l:lF FlF gl }lF llF mF GmYm fmF mmmmmnn0nNndnln+nnnnnF ooopqgqr swssF sF sF tF *tF AtF NtF ]tF tF tF t uF nuF uF uF uF (v3vwF xF xxyF yF yF NzTzF zF zv zzF {F {F {v {{F {F O|F g| o|}F }F ~F S~F }~ ~F ~ ~F ~ ~F D JF F F F F F kF F F ؀j (F "P\_ bF F  F ԃ߃F  F &F I OF + F F F Dž ̅F څF F 6 <F MF yF F F †҆F F F )F 7F CF QF `F F F = ӇF F F 7<F JF UqD}F F F F ƈF ވF F F CF XvF F  F ‰F ډF ׊F JU aF sTF F ȋ͋F F F F )!.-3F EJF s F F mF ՌKڌF KF F F F 1KF l qEx|  F ؍F F `F yF F ܎F O^F ֏_ F 3   F ǑF ߑF   F ;F sF  \ p  F 16F R f pF F  ֓F F  uF F F F F @ Д הF @  F F )F GF YF dF oF F F F ̕F   (=F J7`h F ŖF F 3F tF F ΗE F V !F /a;c N`F F F ĘF ܘEF EF  F F +F eF F F F F (>^l qF F F F ךEܚF F F F ;F dEjF {F F F F F ƛF ՛F F   F &F 49F EF [hF   F ʜF ؜F F  F ',F MF nF  F ؝F F F $ 1F ?EF F ŞF ٞF F F F 8=F KF UZF k qF  F ΟF ~ (C 8~ GF csF ŠˠF ֠ F F :@F K ZF qwF F  ϡF F mF  F ֢ܢF F 0n6F hF nF F ͣnӣF F nF = BF ] rF F F ϤF DF SF F F ¦F ѦF F F F F &F 2F >F JF VF bF nF zF F F F F F §F ΧF ڧF F F F F F "F .F :F QF _F {F F ĨF F F F F F F F ̩F שF F  F #(F >DF bF F F ϪF ۪F  F  F F %*F 6F DIF UF jpF F F F Ϋ ӫF 3 F F &F 2 7F LF XY]F yF F ̬F ݬF F F F !F 2F CF TF n. xF F F F F ͭF ޭF F F &F aF ޯF  F F < CF QF h mF  F ð ȰF ְ ܰF a F  F ' -F El RF aF yF F F űF ڱ߱F v F F 'F =IUafF uF v Z   F вF ڲ߲F F 1[mF ~ E F F & óZ ȳ ѳ ֳE ۳F F F F SF jF F F  д ִF F %F CF aF F F = F ej oF ~F F F F F 4>F U e kF F =F ] F N|Z F 3F F F F F F ,` EF afF F ɹF  #F .F 9U ?F ܺwF *F sF F F F &F 6F FF VF dF }F } F ռڼF F XF dF F F F F ѽF F F F F 3F FF ZF mF F F F *F 5F tF LF F ϿF <F F F "F .F :F FF ^F hmF |F F N7F F Z   E  #; 7F ?Ne7joZ t y E F F F = F LQ WF F F F WF F "F HF VaF o{ F F F F F F F F F F F & 4 KgPF \F p|F F F F F F F 7<F T; oF h F  F F 39F {F Ls Kx%F =F YF n` sF }F F F F F [ F F F F 3 8F B GF SF nF F F F F F _eF F )F .F lF F  F F F F 4F =F p |F F 9F TF {F F F F F 3F ?F F F F F F 0F NF _F  F &?ZF sF F F F )F [F mF F F F F CF TF m F F F OF 49F MRF a fF vF F F F F F F F F *F AF MF jDoF F F F F F F F +F r} V F F _ F $ ,F y_ F F F F F 8F EKF F  F F F mOrF F F bF F F F F &F =F TF `F }         /PF _F pF F F F F F F F F &F 2F <8AF PF _F nF }F F F F F F F  F &F 2F otF F F F F 3F qF }F F F F F F F PF wF F 8F F  F F F F F F $F EF F  F F F F )F ;F GF UF aF nF F F F F F F F F F #F 9F EF WF cF pF F F  F F F $F 3F BF QF ]F glF xF F F F F F F ?F `F |F F F EF fF |F F F F F F F F F & 6F @ GF QqYF dZ nF x F  F F F F F F F 7F F 'F OF \F F F F F $c5cs yF F F F F F ,F F F F F F F (F BF OF F F ,F 9F fF sF  F F F F F F )F F F F F F F F F $F F &F CF OF aF lF F F  F ) F >VF ` exU F F F F F F hF rwF F F F F F F F F F '_ / =F R_ Z iF w ~F  F  F  F F F +:F [ `F  F  F F F F F 2F VxF F F F F F _ F 0F J_ PF jF { F F F F F F F  F fF 5 :F KF \F gF F iF F !FiKF UdF iF F F >F HlF Q F F  F 1 F yF 4f<F iF Q F F  F 1 F 0N0fF F F *0F F 3 F qF  F @F bF rF  F F 0 F X0]F kF yF _ F F  !q&F ? DF a3 F F  F F F #LQF e_ kF F  F  F $F 3F ?F vF F F F F F -F ?F  F F  F F !2F CF _F F F F  F !F : SF 0 F yF fF i"F Qpih F F F 5=F N_ TF rF F F . 3 F P 3 U F t  3 F _ F h F  h F ' 3 , F H h Z q_ F {  F h F h F h F  F  F ' , F 6 C F ` h e F h F  F  F  q F   F & 3 : ? F N F Z C_ rd F h F h F h F h F h  F  F ) F 5 F A F M F ] F o F F F F F F F F F F F F 3h 8F Uh ZF wh |F F F F F F F F h F !h &F Ch SF y~F gF F F F 1h 6F BF `F F Q F  F F QF ^7cF F 7_  F F '7F HWF F F  F  3F gF Q F  F F  F 7AKF fAF F F F F F F <F LF ]F rwF F F F F F F F "F 2F Zfv {F 9 F F F F CF $F .8F BOF Y^qF 9 F F F _ _  <_ O _ ~ F '7F .F LF eF xF F F F F F F F %F AF NF jF {F F F F F F F F F &F BF TF dF { F  F L RF dF  F F dF $d)F 9F m sF F  F F 4Q 9F {_ F F F Q F _ & F C F q x F ~ F _ F F %!N*!F d!F !N!F "F #"d4"F A"dN"F `"~e"F w"_ }"F "F ""F "F #F 0#F ;#F M#a S#F #F # #F ##F #F 3$?$F `$F k$F $F $F $F $F $U%U %F `%e%F %%F %%F %%F %h %F &h &F 8&h =&F Z&D_&F |&h &F &D&F &F &F &F &F &F &F 'F 'F 'F *'F 9'F E'F R'F n'F {'F 'd'F (d (((.( M(DV(F y(F (F ((F (F (]) !)76)F l)F )F )F )F )F * *F * *F *F 7+v N+F _+F r+F + +F + ,F 3, 9,F e, k,F ,F ,F ,F ,F -F G-F i-F - -F -F -F --F - .,.F ;.F V.F f.F .F .F .F .F .F /F /F /F ./F =/F L/F \/F /1 /F /1 / /' /F / / // 0F 0#050F @0F K0DW0F _0g0y0F 00F 0F ?1F d1F z1F 1F 1F 1F 1F 1F 1F 1F 1F 2F (2F a2 g2F 2 2F 2F 2F 2F 3F (3F 3F 3F 94F H4F i4F 4F 4 4F &5n95F Q5W5F 5.5F 5.5F 96M6F e66I66747:7F Z7F e7F 7F 7F 7F 7F 7F 7F 7F 7F 7F 8F 8F M8F 8F 81 8F 81 8 8K 99 9F 97 %9F 19DJ9R9Z9 e9 j9F v9F 9F 9F 9F 9F 9:!:p:N:F : :F :n:m ::F ;;G ;; &;+;F P; ; ;;  < <F .<F U< h<x< < <N<F <<<F <d <D<U <F < <D=F $= @= S=c= w= ==F =g >x>F >>>F > >N>F >G>>N?F ,?i_C_F Q_ w_F _F _F _ _ `F $` )`F D` I`F W`e`k`F `F `F ``F `F ` `F a<aF -a oa- taF aaF aF a a a a` aF bbF )bF ;bCb?ObTbh YbF qbKvbF bz bF bbbbF b'bF bF b<bF #c(cF 6c;cF IcNc@Sc+XcF dcF scF cF cKcF cz cF ccccF c'cF cF dd  dF *dH /dF ;dF GdF mddF dF dF dF dF dF dF e eF !eF +e5eF ?eMeF te<zeF e e& e e eF eeF eF eeF f fF fF .f 3fF TfF {f<fF ffF fF f fF fF f gg@&g+gF 9g{ >g CgF MgRgF bgF gF gF g=ggF gF hhF hF .hF ChHhF ]hbhghF shF hF hhF hF h hhhF hhF ii$i)iU 9i>iF MiF [i`iF ni%siXyiF ~i iF i iiF iiF iF jj j%j*jU :j?jF Nj@SjF ]jbjF njF {jF jF jF kk'k,kU pCpF QpVpF dpipnpF zpF ppp pppF pF p pF qF -q7qF AqKqF UqbqF sqqqF qqF qF qqF qqqF q qrh rF rrF /rF DrPrUrZrF drirF xrF rrF rF rF rF r s shsF ssF -sF hsF s ss sF ssF sF ssF tZtF ttF BtF ^tctF qtvtF ttF tF t ttF u uuF ,u ;uF Tu<Yu ^uF suF u3 uF uF u uF uF uuF uF u vvvF $v{ )vF 3v8vF UvF xv}vF vv vF vvF vF wF !wF 6w;wF Pwv UwF _wdwF |wF wF wF wwF wv wwF xxF xF ?xHxF ]xF xx}xF xF xxF xF yF yF 1y6yF Kyv PyF ^ygyF |yF yyF yyF yF y yF zzF zY%zF 1zF LzQzF fzF pzzF zF zzv zF z zF z zF {{F -{2{F @{YE{F Q{F l{q{F {{{F { {F {F {{F {F {{F |[ |&|2|7|F O|F g|F |||F |v |F ||F |F |F }F ,}F B}N}v S}F j} o}F }} }}}F }{ }F }}}F }}}F }}}F }~F ~{ ~F 1~?~D~ X~l~q~ v~F ~C~F ~~?~~h ~F ~F ~~F F !.F bjoU F F F F F F F &v +F 7F CF MRF jF } F F F F $)U 9?F PF \F kF F F F ʁρF F v F F ,F X^F F F ق<߂F F !F 0F :?F NF X]F F U F ̃<уF ݃F  F  F 2 9F NSF aF otF F F F WƄ˄ЄF c F  F  U +HM ]brwF F F ͅ ҅F F F F cF <F Ȇ͆U ݆F F F F <F F F ',F 6DF W`F y<~F  F F <F BVb. gt yF F F ͉. ҉ۉF F F F 1 =D BF LYF gDlF F F F  F ϊԊF  F WF 'F 1H AMD aZfF p}F ZF ‹F ыF ?F  h F "''F >F PX?diF w h F 'F F F ŌʌF ڌF F $F AFKKF UZF qF @F F F +F ΍F F #(05F Cz HF V[F evF F F ǎ<̎F F @F F +%F 1F @F WF gF zF F F ͏F  F ) QWF |F Ɛ> ܐF  F <Q HNF oF  ʑF ݑF h F h !F 0F IF fh k9pF F F ,,ƒ,˒F ֒F F F F c kF F F F F F /F DF TF y F F F F F ϔF F F D$ *F F ޕF 2?F KF iF Ӗ   |o=]ɦ"} ; E O Y i\~F F F ůF կF F F F F (F @F QF [ bF lqqF F F F F F ,F bF xF F F F ױF F F F FF bF pF J F F òF ֲF F F F %F :F SF _F kF F F F ȳF ޳F F F $F 0F <F aF F F F F F F F EF QF ^F F F ٵF F J F F ,F ?F [aF {F F F F ɶF ۶F F F F )F CF UF oF |F F F F ̷F F F F F 4F DF ]F iF uF F F F ʸF ׸F F +F ee}F F F F F ,F 8F NF iF xF F F F źF ϺֺF =F lEsF F F F ~ !F 7F ^F wF F F ɼF ߼F F !F FF f lF F F F F ŽF ҽF 3F ,F MF \F kF xF F оF F F =F ] cF zF F F F F ɿF F F $F 0F EF QF fF rF F F F F F F F F )F 5F JF VF kF wF F F F F F F F F ,F 8F MF YF nF zF F F F F F F F F =F TF  ( RF \5 cF m:F  F  F )F PF eR x }F >m  E|  F .F =F O[\ gp F F F  F p F F OF &+F 5:F DS ^ r  F     2DP dF d F -d F   !!3F ?F QVF hGs~F s F mx !S Ps UF smxx F F F F F F F F *F 6F JF VF jF {F F F F F F F F F 06F IF ^cF DF DF  F (F J [F w_ F F F F : hF wF  yF LF  TZF  F F dF F Q F < AF ^F z F F Q F &F ;~ AF l_ rF F NF BF Od\F q~v tF  F F 8 =F \F _ F F F !F ,F `F lF F  F F F UF &+F MRF gl xF F DF DF F F F F F )F 5F AF PF \F hF ~TF F F F F F lF F %F 4F @F OF nF yF F F F F F F 2F F  F ErF F F -F TF cF qF F F F 9F OF F F F 8F UF F F F F F F F F F (F 8F HF XF hF wF F F F F F F F F F (F CF b nF yF F  F F  F F (F = \F  F F F F )F U vF F F F F  F  F  AF NF F MgF y_ F F F e!F @bgF F NF 1>F oF F _ $F ?F k &N+F ?_ EF _F |_ F F F F F .F :F IF fDkF uzF F F F DF F F XtDyF eF F  F D JF w |F F F F F F _ F 4F N_ TF nF F F  F ! 0R^_ dF _ F F  F <F ZF eF F F F b F >bDF aF n F F F F F F F .F KDPF ejF yF F h F h F h F D F *D/F LDQF nDtF F F F  F F F F F F F F &F 2F AF MF \F kF wF F F F F F F F F F F F #F 2F AF PF _F vF F  tF F F 3 8F  Gm F  F F JF m F F F F | m   9G!D0?ZF jF xF F F E GF  m F F F ,F K PF o uF F F #F z  F F F F F F 2F EF XF uD{F F @ R\XF l0F IF tF 7F BF  F F F  F #} (F E} XF jF |F F F F F F F F &F JF lF  m Y i  GU gMF ]F gtF ~#F F F F F F #F  :F GSF F (F 7F yF F F F F 5F BF `F F F F F F F F F +F MF jF F F F F F F F  F F /F ;F JF uF F F F F F F F F F 5d :F bF zF ~F F F FF sF F F F F F "F 0F =F JF _F lF ~F F F F F F *4F BF VF F F F 9F LF jF F F F F F 'F <AF V[F jF yF F F F F F >F   F F F F  F 7 B F t F  F F !F 2!F V!w!!F !F " !"4"@"F h"F "F "F $F % %F ;%@%F Q%~ Y%F j%%F %%F % % &&F & j&F v&F &F 'Q '~ F'k'F 'F 'F [(F (F )F G)F ) )F <*F Y*F s*F *F *F *F ++F 9+F V+h [+k+p+F ++F +F +C +F , ,F +,0,F U,Q d,F ,F , ,h ,F ,+,F ,\,, , ,t -  -F -F "-F --F -F --F -F . .F *./.F A.F ].F ... .F )/F q/F /F *0F 0F 0 0F 0N 16!1 51h A1I1 ]1o1F 1C 11F 11F 1Q 22 J2O2T2d2F }2F 2F 2F 2F 2F 3F 83F Q3V3F o33F 3F 3F 3F 3F 4F (4F ?4F N4F 44F 4F 6F -6F U6F m6F 6F 6F 6 6e6F 7 ;7F 8F u8F 8 8e8F 8 9F \9o9F 9n 9F 99F :F .: Q:F `:F j:o:F ~:F :F :F :F :F H;F W;F f;F ;} ;F ;F ;F ;F ;} ;F ;F <F 0<F ?<F N<F ]<F i<F x<F <F <F <F <F < <F = =F &=} +=F 5=:=F @>F O>F l>} q>F >} >F >>F >F >F ?} ?F ?! ?F *?F 6?F K?P?F \?F o?t?F ?F ?F ?F ?F ?F ?F ?} ?F @} @@@F 5@:@F N@F i@F @@F @n @F >A} [AF BiB~B_ BF B_ BF BF B C CF ?C [C aCF C CCF D"D_ (DF eDF D DF DF D7DF D7DF E} EF 'E} MEF bE {E EF E EDEE-GF qGF GF HF HF HF HF HF HF HF IF IF #IF 2IF AIF PIF _IF nIF }IF IF IF IF IF IF IF IF IF JF /JF QJF dJF JF JF JF JF jL5LLF ML ^MrMF MF MF MF MF NF +NF =NF MNF iNF NF NF NF NF NF NF NF OF IOF XOF gOF OF OF OF OF OF OF OF OF OF PF PF .PF GPF ]PF qPF PF PF PF PF PF PF QF QF *QF 9QF fQF QF QF QF QF QF QF RF "RF 1RF BRF QRF aRF RF RF RF RF SF SF *SF XSF SF SF SF SF SF SF TF 4TF CTF TTF cTF zTF TF TF TF TF -UF GUF VUF oUF ~UF UF UF UF UF UF UF VF "VF 3VF BVF YVF VF VF VF VF VF VF WF WF F k8JF \2dF zF F ΀F ݀F F F F &F 7 =F NF bF F 2ȁF ց22F 2lF  F F <F m|F σF F -F MF yF ބF F 0F F\F D  F 8F GF VF eF tF F F F F 2F /27F Y uF z҈F zF izF ̉F F Iz"  F mzF F F F F F =F dF uF F + F ӌF F F ȍF F F -JF VF hF zF F F F ˎF F F 9>F }@ F F F ʏw b F F qF F VF -F <F RF sF F F F F ƖF bF F F ڗߗF F -RF w̘?3F _?jw??%:QVEi|Sww,Nn+wWF F  F PW#F E TF F F %^F F wF F F QF \F nF F F F F  GF F EF F YF F ̨F F F )F AF PF kF zF F F F ĩF F F ,F ;F KF xF F F F $F IF ΫJmF F 8F Xm[F  (0FNdl߮F A_aF __ = W c }ͳ`_q_ @_c F F ߻F F F CF fF F F ԼF EF r F F F |F F F ԾF $F aF F F F F aF  F   F  ( 8F > F F  5F MR\F F F ;.  .  K .   ; BM. T [ pZ   F     %F < H M jF z F F F F  F " '.F gF sF F 8 U 8 PF dF  m  F ! 'F aIhF  F eeF eOF [F r }  F F F F F F /m @F Hgdv} F } F nF F F &+F @EF b} gF yF F F F   F 2 F 'F <F TF h |F oF F F F F } |F F gggF F F F F F F F 6F EF QF ]F iF uF F F F F F F F F F F F F F F ,F ;F GF SF _F kF wF F F F F F F F F F ZF F F F 'F AF dF sF F F F F F F F ,F ;F KF \F mF |F F F F F F F F *F ;F GF XF dF uF F F F F F F F F F 4F S XF w |F  F  F F F F F M]UdzUUUF F F F F F F F F F F F #F 4DUIF XF dF pF |F F F F F F F F F  UF %F 1F =F N^UcF rF ~F F F UF UF F F F F $F LF  F F F #F NZ S f kF zF F F P P F F P F   F 8F VF tF F F = F 7< H[F l q#vF F } } F F UgF F  } F  #" ?} DF gsF F F F ~F  F  F LF kF F F F F F '& 8& =Z B G Q#VF eF tF F F LF F 1 6F UzZjzq   F F F F F F F F pl #F 4Z 9 > Z _mprlw #F   F  Z   F  F TF $F .! 4F F F F F F F F F F -g<F KF ZF iF yF F F F F F F `F F F F F  F $F 3F YsxF zF F F 4 \/4F CF Q< V [F in:sF F F F F F F )4 9>\NSF y  F zzF F F F F 9F 4 \F F F F F ( -< 2 7F AFF r wF F  F < F F  F 4 @zMF ^joF y~F F     h F F F F %?16F N _F i"vF  F *F F F F F F P ) < O b g4 w|\  z F 4 \ F F 7F T }  F F F F  F F F  F F F F f F  F #F ;@F UF k pF z< Z F F F     #E4F OF [F eoF F F F F F zF ,& 1 6 JOF [@kpF  F F  F  F  F / 5F HF ZF nF F F   F  F ! F 1 F G F \ F  F  F  F 3 F h m F w | F F  F F    F  F  F   F 4 F L F y    F F F F  F F F F  F  F ( F F  ^ d F F  F T F  F F F  F " F , Z V _ F i u  F  F d F F F  F  F F $F 0F <AF MF WdF S F F F F F S F #F 9>F VF eF zF S F F 4 F F $F IF fF rF F  iF S F F 4 \/4F Oz^F hpF F  iF S F F zF Y ^F sxF  F F F F F  F *F HF TF c\sx4 F F F F F F F #F 9F CHF RXF     h F F F F F -9MZRF \aF xF ?F  F  F F z F #F 24 BGF VF eF qF F F F  F 4 9F CMzRF \aF yF  F F @F ! F F ( -F < AJ S_zdF n F F > F F  F F GF $3F 8 CF Y^F hzF  F TF F  F F 4F UF kF F F F F @MF yF F  F  F (-F <F X uF F F F F \$ z$ !F 0:F QF kz}F F F F \F  F ! F )F 8> =F T YF f kF uF _F F F "F =F MF iF sF F F F F F  _ F    F & F 5 F D F N \ F o -t F F  F F F F F F !!F &!F 7!C!H!F R!W!F o!F ! !F !!F ! !!F !h !F !F !!F "F "$")"."F 8"="F M"F c"F o"F y"~"F "F ""F "]""!" "F "" #F ## #F ,#1#F H#F b#g#F q#v#F # #F #F # # ### $$F $ %$F 9$ A$ M$F [$ b$ g$F q$v$F $ $F $$F $F $$F %z %F (% 9%F L%F Y%a% y%~%<%F %%F %F %F %F %F %%?%&h &F &&F B& O&F ~&F &F & &F &F 'F '','_1'F N'S'F b'F q'F }'F 'F 'F ''F 'F 'F (F (z%(F 5(F _(F m( v(-{(F (S (F ((F (K(F (K(F ((F (F () )F /)F Z)_)F v)F ))F )F ) )-)F )S )F ))F *K*F *K*F &*-*F 9*F C*W*\*F *F *< *F *F *F *F +F ++F 0+F >+< O+F [+F t+F +F +++F ++F ,F ,< #,F /,F H,F j,F ,P ,, ,\ ,z,z,,F ,,F --\--F 8-=-F R-W-F j-o-F -F -F -F -F --F --F .F $. *.F @.I. S.\ \.F q.z.z.F .z.z.F ..F ..4 / /F \/a/< f/ v/X|/F /S //F 0!0F 80 >0F O0F [0F 0 0F 0F 0F 0F 00F 00F 0F 01F 1F $1@11F >10Q1F _1< p1F |1F 1F 1F 11 1\ 1z1z2F 2z)2z.2F ?2H2F f2k2F u2z2F 22F 2F 2F 2F 2F 2F 2F 3F 63F B3F P3:U3F j3F t3*y3F 3F 3F 3F 3_3F 3 3D 3F 33F 4H 4F #4?/444F >4D4F q4F 4 44 4F 44F 44F 55F N5T5F ~5 5F 5 5F 5 5F 5F 6"6F t6 y6F 66 6z6z7F 74 /757F G7F c7 q7 {7F 7F 7F 7F 7F 8 #8 -8F E8F n8F 8F 8F 8 8F 8F 8F 9  9F .9C9F R9Z9F _9o9F 9 9F 99$ 9$ 9z9z9$ 9F ::F : :z:z;F ;F E;F P;F Z;q;F ;; ;;z;F ; ;X;^;;F ;<$ <z<$ *</<4<F C<F R<F ^<F n<F <<Z <2<F <<F <S T=Y=F v={=F =F =F ==F ="==F =F =0>F >#>z(>F E>J>F T>Y>f>F >F >F >+>F >>F >F >< >F >F ?4 ?? ?F '?4?F B?< G?F _?F k?F x?F ?F ?4 ??F ?4?F ?F ??F ?@F @F +@7@K@ZP@F Z@_@F v@F @@@F @ @@@ @^@AF A'A$ :Az?A$ EAF oA {AAF AAAF AF A9 AF AF AF AF BF BBF 'BF :B ?B GB SBXB]B bBh gBlBF xBF BBF DeDDeDE'EE EEF!FfFFFHzHHHHI>IIJJ KF &KF 5KF DKF aKF KF KF KF KF LF LF LF MF MF NF 'NF 3NF iNP qNF NF NNNF OOF dOjOF yOF OF OF OF OF PF )P GPF [P>jPoPF PPF PF P PF QF QF *QF 9QF HQF ZQF oQuQF QF QQF QF QQj QF QF RF RF RF .RF ARF PRF \RF jRF yRF RF RF RF RF RF RF RF SF SF .SF ;SF RSF aSF oSF }SF SF SF SF SF SF SF TF TF TF 5TF [TF yTTF Tn TF TF UF @UF aUUF UF UF UF UF UF UF @VVF VF VF VF $WF 9WF NWF cWF tWF WF WF W WF XF BX GXF XF XF XF YF @YF bYF Y YF YF 8Z>ZF yZZZF ZZF #[=[L[F ?\F ___paF |aF a aF b3 bF ,b xbbF bF c cF ;c [cF sccc} cF kdydF dddF e} eF eF JfF ffF sf- xfF fF fF fF gF gF $gF 0gF ?gF NgF ^gF tgF ggF gF gF gF gF hF #h)hF FhF `hF hDhF hYhF h- hF hF hF i iF i8iF KiF ZiF di2iiE tiF ~iiF iF iF iF iF iF iF iF jF jF jF )jF 5jF AjF MjF YjF ejF qjF jF jF jF jF jF jF jF jF jF jF jF kF kF kF (kF 7kF CkF OkF [kF gkF ~kF kF kF kF kF kF &lF llF lF lF lF mF !mF 7mF JmF ZmF mF mF mF mF mF mF mF mF nF )nF nF nF nF nF nF nF nF oF oF &oF 2oF >oF RoF aoF moF {oF oF oF oF oF oF oF oF oF oF pF -p 2pF Qp VpF up zpF p pF pF pF pF q qF qF ,qF F F ˔ ܔF 5BF L^F mGrF F F  F ŕF ϕF  F "T(F ;F ETF  F ז F F F +F :DF XF r F F F ǗF ֗9 ۗF F F F F #r(F 4F CF ?F ŘۘF  F ! F &3F B> GF ^ cF p uF ?e F ʙϙF ٙޙF F F _!.F PF aF F F F ÚF ͚F F F "F /F @F O TF `F oF ~F F -F F ̛ћF ݛF F F F 4F RF ^F hmF F F F ĜF ڜF F F +F MF jF tyF F F Ɲ˝F F F *F GLF VdF rF F F ʞF k  F 4 /4F INF jF F F F şF ՟ڟF F F F ',F 6HF VgF sF F F Ѡk ߠ F 4  \ F 5:F FF RF ]sF F ġF СF ܡF F F F -?9>F MF \F ftF } F ǢբڢF ? F !F 7HF [nF {F F ʣ ϣۣ}  F F 6F Nbv {F F   ĤF F F *4 :@F F F )F FKF b hF yF F  F F ަF F F F  %F GF ^oF {F F F ٧k  F  F "'F 16F IF SXF oF ~F F F F ɨF F F  F F ',F 8F GF _F r  F F F ũF ѩF ݩF F F  F (F EF X h mF F F F F F FLF  ͫ ۫ F !F M^F u4 F F  ĬF ܬF F  )F AF `F wF F F ʭЭF J V g îF ۮF F F 1F K PF qv{F F F F F Z 2F F %F F ɰΰF ްF F F  F 7F Q VF sxF F F ±F αF ߱4  F F #F ;F GF TF vF 4 F 4F F ˲вF ڲ߲F F F !F :F \F wF F F ijF гF ݳF F F 4D 9F EF O\F m?y~F 3F F F ŴqشF  F -F 9F J4 Z_\otF F  F  F F ޵F F F ,F <F i4 y~\F  Ͷ ٶ F F F F 1F VF 4 \ƷF зշF F F (F E JO TF ^cF  F F ϸ ԸF ޸F F - 2F <AF m rF |F F ѹ ݹ F F F F %*Z /F ;F KF aF kxF   F F ĺF ۺF   D  d F #(F ?F S_kpF z?F 3F ɻF ػF qF  F %F 4F CF RF ^F jF k F     F F 3F >F f kF xF F  F F 5F JF Xf ]F k yF F F F о վF ߾Z F F F #( 1BP a m rwEF  ĿF  F F =BF NF ZF jF F .3F ?F KF WF cZ hF uzF F F F F F $F EJF f )F  F F F  $F /F 8 CF L ZF h F < F F  8M w g Yo @uW   & E )x 1 Ex V D@ Nb  F F F 0F ?F jF F F F F  F F aF ntF F F  F _F !'F _ F ; F @ F ;F F LF F ,]F j F F F F +F C]F F  F  F F _F lrF  F ;. 6F hF F LF NF [F  F F ) D eF rxF F F ,@)EF Z pF F F F F  GLF WF djF |F F F F ' "F /* \F inF }F F F F  ' F +1F CF fF ~F F F F   F .F ;* hF uzF F F F F  *F 7DF QVF eF F XF Xxz, ;<    : A   #x + N m x  9R (x   = `'^x  4F KF bF sF F F F q>F oF F F F BF bF F F F F +F ZF F F F F F F #F ?F VF F F F F 5F eF F F *F NF ZF F F F (F 3F iF F F F F 'F 2F <qAF KPF ZS_F iSnF x5}F 5F F F F GF sF F q> 'D sF }SF F 5F SF qF 5F SF SF F q"F ,51F ;5X*lF vS{F F F SF  F F SF SF  F  F %*F 45QteF otF ~ F F F F F F SF  F F #F -5<F Y mF wS|F |F  F SF C F  F SF SF | F C F & +F 55DF b uF SF |F  F SF C F  F S F SF $|)F 3C 8F B GF Q5`F rF F F F F F F F IF aF lF |F F F F F F (F FF RF F F F F F F F F F (F 7F CF OF ^F mF |F F F F F F F 2F =F ZF iF F F F F F F -F >F JF F F F F "F .F IF bzF F xF F F F F F F 6F QcuF F F F F F F F F /F >F MF F F F F F F F F #F 7F BF ZF eF zF F F F F F F F F F F !F -F 9F EF VF aF mF |F F F F F F F F F F F F ,F =F KF tF F F F F F F F F F F F F F /F CF QF fF rF }F F F F F F F L F  F F F F  F t F F F F F  F  F 7 F F F  F F F  F L Q F g F } F F F F F F  F  F F F F 0F F F 8F GF QZF jF {F F F F F F pF F F .F PF rF }F F F F F F *F OF Y^F iF uF F F F F F F YF nF {F F F F F F F F F F ;F SF F QF iF yF F F F F F F F F >F lF F F F F F F F F F F "F FF PUF dF F F F F F F F F F F F DF {F F F F F F F 4F AF xF F F F F F F F OF jF F F F F F F F F #F 1F aF F F SF 5F *q>  #  , D  !:!p!x!F !p!F !!F !H! !F !S !F !d!F "%"F D"F `"F l"F x"F "F "F "F "F "F "F "F "F "F "F "F \#F #F #F #F #F #F $F U$hq$F $F $F $F #%F C%F R%F %F %F %F &F 7&F P&F e& &F & &' 'F E' Q'c'n'F |' '' 'F '= ''F ((F (F )(F C(F R(F ^(F {((F ( (p ( (F (F (F (F (F (F )p )F -)F C)nH)F T)F k) p)F ) )F ) )F ) )F ) )F ) )F * "*F 9* >*F U* Z*F q* v*F * *F * *F * *F * + +F #+ (+F ?+ D+F [+ `+F w+ |+F + + ++,,i #,?,D,F U,VZ,F k,,, ,,F ,F ,7,F ,,,n,n -F -*-Dw-F -- -F - -F .F 2. M.F ^. y.F .F .F .F .F .F .F .F /F /F +/F :/F I/F X/F g/F s/F /F /F /F 0F 0F *0F <0F N0F V0x 00F 0x 0 00F V1F 1F 527:2F V2n[2F v2G}22F 2F 2F /3F F3F 3F 3F 3F 3F 4F ^4F k4F 445)555F A5F x5F 5F 5F 5F 5F 5F 5F 5F 6 6A6d6s66F 6F 666677]7u7F 77F 7F 7F #8c88F 88F 9F G9F V9c9F 9F 9;F [;F p;nu;F ;F ;F ;F <n <F .<s><nC<F T<F c<F x<n<F =; =F (=F <=hA=F P=q===h=F >"5> S>"> >>~>>"p? ?y ?/?$?? ?4?M?"@F ,@F A@F Y@F e@F }@F @n@F @F @n@F @F AF AF -A2AF ?AuKAF ^AF qAF AF AF A AF AF B bB qBF ~BuBF BBF BF BF BF BnBF Cn$CF PC aC CF CF CuCF CCF D D ,DF kDnpDF DF D" EF MEuSEF eEkEF EEF E FF 9FF FuFF FF FF FF FF GF 1GF =GF mG GF GnG GF HF 'HF GHF VHF eHF tHF HF HF HF HF HF HF HF IF IF /IF DIF SIF bIF xIF IF IF IF IF IF IF IF JF JF )JF 8JF GJF VJF eJF tJF JF JF JF JF JF JF JF JF KF (KF 7KF GKF WKF gKF wKF KF KF KF KF KF KF KF KF LF LF 3LF CLF SLF fLF yLF LF LF LF LF LF LF LF LF MF %MF 5MF EMF XMF nMF MF MF MF MF MF MF MF NF NF NF 'NF 5NF CNF QNF _NF #OWOF pOF OF OF OF OF !PF .PF ^PF PF IQF ZQF kQF |QF QF QF QF RF RF fRRF #SF 4SF ESF VSF SF SF SF SF TF CTF PTF zTF TF TF TF UF &UF 3UF KUF pVF VF VF VF W W $WF )W F XF fF tF F ŀF ԀF ߀F  F !F 4F WF dMiF xF F F F F ʁρF ہF F F F F (F 7F FF dF ނF F F )F YF lF wF  F F փF F 3F ISF k  F ɄF w F F (F 3F XF eF F ɅF ߅F F F F $F 9 >F OF F F  F F F -F 8 @ w Ì F ?F _yfF F  F F F F MF [F +F -F iF F F F ŏF ҏF F "F 8F fkF |F F F F ͐F ܐF F F F JF VF bF }F F F F F 7F WF xF F F ȒF F F &F rF F F ٓF F F F BF YF sF F F ƔF F F F /F OF [F F F F ƕF ٕF F F 6F PF jF F F ɖF F F F F F .F =F kF ~F F F F טF F F F %F CF F F F řF ԙF F F \F wF F F ΚF aF -F aF rF F ͛F ܛF F F F F 'F 6F EF QF ]F paF F F F ʜF ؜F F F F F F .F =F LF XF gF sF F F F aF ĝF F $F ?F SF kF F F F F F ˞F מF F MF oF F F F F F F F F /F >F RF ^F jF yF F F F F aF РF F !F .F TF cF F T ɡF F (F 4F ^F mF aF F F =T MF qF F F ˣF F 2T BF aF nF F @F KF VF zF T F ֥F F 8F NF aafF F F ˦F F :T T קܧF F T /T ?F jF F ԨF F 7F CF bT F ũF ۩F F 3F ?F LF xF F F F ժF F F F F /F AF SF eF F ǫF F 4F KF iF F F լF .F ZF F F F F *F Oe aF v]{F F  F F ˮ֮3 F  Tz F * /F >F it F   ůF Я F  F F F F `mF F F F F ˰F װF  F  0F ?F UF iF |F F F F VF tF F F βF F F F :F JF F F >F F F j  F F 0Y @F VF ĶF *F F F ÷*ɷF ۷F |)MAkAAF F ]øF ϸF AA F -F LF ϹF -3F MY Y F ź|ٺF A=ASY ioF F F F ԻPڻF |F ,PSY F Y ޼F F .8KF e% oF F Y F ĽY  %F ;F MF oF F F F ǾF ھF F F F F &F 8F IF \F lF F F F F F ԿF F F %F tF F F F F 005F KPF bjF F F F F 'F =F OF _F xF F F F F F F F #F <F QF oF F F F F $F GF YF eF q F  F < F F F F F '"F 9F YF F F F F F F !Y OTF xY F F F F F 'F @F ^F F  F (F (F (F ( F 7(<F S(X]F k pz F F %F TF yF F F F F F j F aF rF ]]Y F ]&F F*RF _F qF F  ]F |F QY grF ]F F ]F |Y 4F JOTF gF tF F F F F F F F F F -F <F K |F F F F 4F aF }F F F  #8CF `fF wF F F F F % ,F DF }F F F ) QF ]Y mF F F  Y Y F [Y }F F F F F F <F KF YF kF F F F F 'F 3F HF zF F F F F F F F +F \F v{F F F  %9F eF Q jF Y F F PVF qF F F F ]F F F F F F -F 9Y LF ^F {F F F F F ,Y DU]]e `k F F Y F F )(VF eF F F F F -F 9Y DF XF sF F F F F 9]A GF rwF F F F F F F F F F F F F F 27F QVF e r wF F F F F F F F F F "F 2F WF qF F F F F F =F ZF vF F F -6F KF bF F F F F 3F KF VF F F F 2F YsF F F F F  F  F F F F 2F EF XF oF eF pF |F F F  F "F .F :F SF F  F F r "F ,@lFF Vr F F TF wF L QF [ouF } F F F $Y *F 2^+cF mt F +F F F 1 EF U FF  CF RF e yF  FF  kF F F F  F F 3 9F E_ QF zF F F F 3 HF d iF tF F F F  F  F 5F F F F F F JF [F oF F F F F F *F 9iF {F F F F F HF ZF wF F F F )F D TF `F lF xF F F F F F F F F F ^F uF F F F F F F F $F .8F BGF [F ejF F  F F F F  F F F , 1F @F N SF bF lyF F F   F F F F  F 0F GF Z_F nF | F F F F  F F F F $ )F AF Y^F mF { F F F F  F F F F #F ;F VF gF qvF F F   &| F $, 4 9F N nZ xC"    F &.v6{>ZFyNV ^m F F F F F F n F MF ZF I F F F F F F F F ,F 6;F JF W^\F fkF yF F F F F UF F F F F F F F F 9 >F MF [`F j^ xF  F F F F F F ).F FF [ `F F F F F F F !F 05F AF K^F iF uF F F F F F F F F F F 05F CPF aF RF F F F F  F <RAF PF ^dF odF F F F F F F F #(F >SCF OF [F ejF F   F F F   F  F - 2 F I F  F F   F F F  F ( - F < F O [ o  F F F F F  F  F " F . F = F _ F _ F F ) F F F F F -  F 2 F > F \ F i F  _ 2 F F  F ( -F JF VF sh yF F F F F F F }F F !F 0F ?F NF ]F lF {F F F F F F F  )F 5F hF F FF F F  $F wv F F F F F .F HF TF ~F F F ?, UF F F F ? F 7F CF F F F F F F F F F F F %F JQ OF `_ fF F F F mF A F S0XF y F F  F F FF WF gF F F F F F F h F h F %h *F Gh LF ih nv_ _   pF F F F F F F F F !(F 8F hF F IF XF p F F F F F F * 8hF ryF ^F F F '2F JRF uI  F " * F M _ I F U n !F !F , F,F i,F ~,F ,F ,F ,F ,F ,F ,F -F ---F -F -F .F .F .F +.F 7.F C.F T.F `.F l.F x.F .F .F .F .F .F .F / /a / -/F B/F S/F l/F /F /F /F /F /F /F //F //F 0g 0H0F 0(0F 40F C0F R0F w0 |0F 0F 0F 0F 00F 0 0F 1F 1F 11F ;1@1F O1F ]1F {1F 11F 1F 1 1F 111F 2F $2F .232F B2F `2F 2F 2R272F 2F 22F 2F 263F 3%3F 3%3F =3F Y3F k3F ~3 3 3F 33F 3F 3F 33 3 3F 34F 44F 44 94 >4F H4U4F m4r4F |44F 4R4F 4F 4A4 4F 4F 45 5F 5F 95>5F H5^5c5F r5F 5F 565F 55 5 5F 6S6F '666F E6F \6F q6F 66F 6F 6F 6F 6F 77 7 #7F 57F H7]7F y7F 7W7F 77 7F 7F 7F 8F 8 8F $8;8G8T8F g88F 88F 88F 88F 8F "9F 599F 9F 9F 999F 9F 9F 99F :::F :F ::F :F ::F :::F ;F ;F 2;7;F A;F;F [;F n;; ;F ;;F ;F ;F ;F <F '<F ><C<F O<F j<F }<<b <F <F <F <F <<F ==F !=&=F G=F R= q=F =F = =F =F =F =F >F > $>F G>F V>F e>F t>F >F >F >F >F >F > >F ?_ ?F ;?F G?F b?F ? ? ?F ? ?_ ?F 0@F N@F l@F y@F @@8 @F @F A AF $AF 1AF EAqAF AF AF AF AF AF AF AF AF BF BF $BF :BF RB nBF zBF BF BF CF CF 'CF BCF ZC rCF Cv CF CF CF -DF GDF aDF DF DE &EF RE fEF EEF EEF FF +FF ?FF OFF FF F FF GF 0GQ 5GF FG_ UGF nGF GF GA GF GGF GAGF BH0HHF lHF HHF H HF H1 HF IF 8IEIF ZIpIF ~IF IF IF IF IF IF IF IF JF JF 8JF ]JQ J_ J_ J J ^KF rKF ~KF KF KF KF KF KF KF LF LF 'LF 5LF MLF cLF LF LF LF MMF cF d dF #dQd VdF idudF dF dF ddF dF dF e: =e ReF ye: e eeF eefF f&fFf dfF f: f fF fF fg: gF Hg g g g: *h Sh h h h: h 'i: Zi i: ii i j 3j aj j j j j k Ck: mk k: k k: l lF +lF hl: l l l l #m Qm }m: m m: mF n F _F kF u F F F .4F iF uF  F F    F >F qF   F F EF F F F /F OF F F F F B SF zF F F  F !F @F RF F  F F F F "F 9F EF aF F ] eF s  F  cF F  F F ,1F >CF PUF boF F F F "F 7 E S oF  F    F   0  F | F F F F F ' 7F LF XF dF sF F F F  4F _fr F F   "F 5F W^iF !BctF F F F F F  "F .F :F IF lF tF F F F HF XF qt{F % F F fF F F F  F %e,1< AH(X ]F F F cF F F  <F QF q vF F e1 F ( cF (F DF h cF F F  F F F +F bGgF F F F F F F F F F #F /F ;F NF bxF   F F F F F F .F CF RF aF mF yF F F F F F F F F F F (F 4F @EF TF cF oF ~F F F F F F F F F F F "F x  F F  !-F TgF ~ F .F R guF   F !&F HF WF fF uF F   } F F EF WF qF F F F F F 'F 3F F OF ry F F ~  # 3F =] gF q F F D P  F F 8F Ml ] hF sF F  F F : HF qF M33F F F F F F F F F F O3b3gF F F F   F E 3 @F Ua  F  F % */% ; DF kv{% %   F % %F 3 JDej% qF  D%  F % ;@% in% % % % % ! *F RW% {%  F o % F o % !DI% ]h% % F F F F % 9F H{MOY_ mrF  F 4F @F J `F oF ~F F F F F F F F   M!N *F HuT lx F F  F  OF  % F F /F >F `F mF F F F F 6; @F V_ \F F F F F F F , 9>F ]f= q u F F  F F F !&F 2 DIF tF F F F F F F  F 8F UZF jF F F F F F &F 7J _jv F F F F F F F F  F &F 4F @F e xF    F  F ' ;s@( RrW( F    F 8 K [F  F  F F F ejF  F F F F  F *1 CQ] ^cF F F  F _ _ F ,%9F EF d] x]  F F F  F #F 8 I sF F F F F F F   F $F 0F X]F iF v|F  F F  F F F F +> S^| F  F F  .F : KF aF u_ F F F F     F < A % M _ R F a F p F  F F F F E ]     _ F F * _ N F _ F o F F F F F w F W F  F F = F F  F  `  F T F h F F F F  F F <MF [F uF F F F _ F F F F F F F 7F IF _F kF wF F F F F F _ F F + 0F <F LF qF F F F F F F F *F GF SF afF F F F 1F =F IF UF }F F % F LF XF yF +F 7F EF SF _F yF F  F F F F F F _ F &F K9 TF aF m xF 3F  F  F  F  F F F %3*F ?3DF RF jF F F  F _ F %3F TF _ F %  F )F D [F sF F F F F F F F ,IF b y  F F  F  F +F UgF rF F F F F F F  F F "<F \F oF F F   F F F F !F .<F HF UcF oF |F F F F F F F F * >E HF TF `F m| E F F F F  E F F  F F 1F >CF bF mF zF F F sF F F F  F s F 3 IF TF cF rF F F F F F F F F F  # F <  L F X  t F F   F !F !F )!f :!F I!F n!/|!_ !F !F !F !F !n )"F A"F M"F t" y"F ""F "F "F "F """F "F #F ###F 2#F A#F N#[# f#F x#F #F ##F #F # #F #N #F #$F $ $F 1$6$F$ M$F _$F $ $g $ $ $ $F $ %D% %F ,% C%DZ%_%% %%% %F %%%% %F %F % %F %F &F 2&_ 7&F L&_ Q&F ]&F m&F y& &F &&F & 'F 'F W'F c'F ~' 'F 'G' ' ' 'P ((F (F @(F L(F g( }(F (F (F ( (F (F ( )F ) )F )F )k)F +*0*% 5*F H*_ s*F *F *F *F **% *F *_ *F +_ ++_ 0+F F+F _+_ d+ y+F ++F +F +F ++F +F ++F ,F ,,F &,F 3,=,F I,F V,[,C i,F ,F ,,F ,F ,,F ,F ,--F -F "-F /-7-F C-F P-]-F h-F u-}-F -F --F -F --F -F --F -F ..F &. 3.F ?.F L.Q.F ].F g. . . ..F .F .F . /F // 7/F C/F P/W/F l/F / /F /F //F /F /F / 0F *020F J0`0F l0F x0F 0F 0F 0F 0F 0F 0F 0F 0F 0F 0F 1F 1F "1F .1F :1F F1F R1F _1F k1 w1F 1 1F 1 1F 1 1F 1F 1F 1F 1 2F 2 2F *2F 92F G2F U2F a2F m2F y2F 2F 2F 2F 2F 2F 2F 2F 2F 2F 3F 3F 3F $3F 33F B3F Q3F `3F o3F ~3F 3F 3F 3F 3F 3F 3F 33u34 454A4 Y4o4444F 4F 4F 4F 4F 4F 4F 4F 5F 5F #5F 15F ?5F K5F Z5F h5F v5F 5F 5F 5F 5F 5F 5F 5F 5F 5F 5F 5F 6F 6F #6F /6F ;6 @6F L6F X6F g6F v6F 6F 6F 6F 6F 6 66F 6Y6F 7c 7F 7F 07F B7F T7F f7F 7F 7Y7F 7F 777F 8  8F -838F H8F Y8l^8 c8F o8 {8F 888F 888F '9F @9F L9F Y9^9 9F 9F 9 9F :_ :F !:F 5:F W: \:Ua:F m:F z::_ :F :F ::0:F : :U:F :F ::_ :F +; A;F;F l;_ q;F };F ; ; ; ;F <F .<F B<c<q{< <F <F <<F =F =F *=F j=F y=F =F =F ==F >F >F 0>F H>F v>F >F >F >F >F >F ? ?F 5? M?F a?F z?c?F ? ?F ?F ? @ @@F 2@>@F@F Q@i@{@F @@k@F @F @F A AF iAA AF A AF B &BF :BF nB ~BF B BF BF BF BF CF CF CF 3CF LCF eCF C C C CF CF CCF D*DQDF [D DF DF DF DF DF DF DF DF DF DF EF (Ee/E1BE UEiEoEvEF {EeEF EEF EF EeEF EEF EEF EEF E EF FFF FF F)FF 3F9FF >F IF9NFF ]FF mFF FF FF FF FF FF FF FF FF FF GF GF GF )GF 8G =GU]GjGwGGGGGG G G GPHF cHF oHF HF HJ HF HF HIF -I =I QI ZIcIF xI~ }IF IF IF JF C% dqA }F % ӑؑ% A #% O: YF sF A F % A 9>% j: wF F % A ,1% b: F Ĕɔ% ۔A % :: KF ^F F ˕Е% A % A: RF hF F +0% BJA pu% : ۗ: F F ;F LF ]F nF F F Ę ҘF F $ 1F % ę љF % $)% JO% rA F ͚Қ% A %% Q: bF oF  ΛF F 3F CH% [F gA ĜF % 1?A mr% ȝF F F )F 7F LF aF vF F F F A ( Y^% p~A % ݟ:  ERA e % ʠA % !: h  Ρӡ% A % D: o  բڢ% A % K: v  ۣ% A %% Q: |  % A ',% X:   % A +0% \:  æ % A ,1% ]:  ˧ 8=% OWA }% : ݨ: , Z   ީ <F Ūʪ% % A 05% TY% ~% % *  F F F F HF % ,1% MR% dlA % % % HM% pu% ¯% % "% EJ% sx% * ɰF F 7<% qv% F ͲӲ% 08A [bg% lq% ³dz% * "'17EF UF irF % A -2% ~* F F  _d% v~A % * Y    % 19A \a% *  8 ^   ̹  n F к HM% _gA % % ٻ޻% % !&% EJ% in% % % ռڼ% % "% AF% ej% * [ zF ¾   2 ?PF c F  F % % %*% 2Z cF q %  F o % % % >C% U]A % % % !&% W`A  6 _ A  F rr',% Erjo% % A % : T YF rr( F   +F @R s srF  s$rN x% % % A % "8Ilq% }F % % % -SA s* / S     A g     sArAs( r(  : _  F F   c8F pu% % A c% /: TF u  F  D(-% ?GA mr% : yF F F &F =vF % A F  % 1} % % F  % +0% \: {6F BF L ZF hF F F  F F F F  3F ?F I `F kF F  F F % F F SF _F i F % F F _ F F % !F +8=F ^~q] F F ] F 1_ 6F BF WF eF F F  F F % 7F NF ZF F F F  F YF % F _ F F F F F F  $F }F F /F % F F :FF Wj  F L `F F F #= KYF F  F F F <F H OF n_ sF F  } 'F MRF ^F F % A $)% k* * TF bF pF F F F  Q% F F  F % F CH% MF W_F rF y F F _ F F F  F <Ay FF RF l_ qF % % y ;@% X]y |% F  F F % "F gl% % % A % [* F F F F * .A X* sF  F F F F yF !'2]F iF F F F F F F F F 0K] "KF nF E F E -E <KPF _iqE xF E F F { #8EqF F vF  F F   L _      )F VF  F F E F F F F  QF F F 4F mF F F F  F  !F <F F F F F F { F 9 JF  F F F !&0?F N\% % %  A 16% {* F F PU% goA % * F F F DF % A % * 7F EF TF F % % 7<% NVA |% * F F F $F _F F F F 9  B K F i n F F F F F / F ] F  F  F  F  F  F ) F ^ F v F  F  F  F  F  F  F  F   F  F  F : F ` F w | F  F  F  F  F &  D F v F    F  F  F B a  F  F  F  _  F , ~ C F s F     %  F  F ] b % q F  F  F  F  _  F  F  F  F  F ( - F ; [  s F }  F  F  F  F F F F  F  F = F V ] h  F F    F : ? F M n |   F F F F F F F F F  F + F : F F F U F d F s F  F F F F F F F F F  F  *  < F V  a  f F r F  F F     F F  F  F  F '  , F I F X F g F v F  _  F  F  F . F [ F  F  F  F  F ) F C F _ F  F  F    F  F  F  F & u4 @ F T a F {   _  _  M u   F  F  F  F I F a F { F  F  F  _  M u   F  F ( F ; u@  E F X  a F m F  u   F  F      F  F  F " F      F  F  F , F ; F G F S F f _  F      F  F  F  F  F    F  F      F  F  F % F 4 F @ F L F X F k _  F      F  F  F  F  F  F  ! F     F  F  F / F ; F G F S F f _ r F  F  F  F  F < F  F  F  F  F  F  F  F  F  F  F  }  F  F ,  8 _ r F  F  F  F  F 7 } < F H F V  b _ n y     F     0 F v { F  F  F  F   F  F K F \ a f F w F  F  F  F 4 F k F   % F D! F T! Y! % ! ! % ! : ! F ! F +" F M" R" % " " % " : " : " F " F # F m# F }# # % # # % # : # F !$ F P$ F r$ w$ % $ $ % $ : % : .% F =% F V% _% F j% F % F % % % & & % /& : C& F & F & & % & & % ' : ' F t' F ' ' % ' ' % ' : '  7( F G( L( % ( ( % ( : ( F ) F ) #) % l) q) % ) : ) F ) F * * % \* a* % |* : * F * F + + % >+ C+ % ^+ : r+ F + + % + : ,  (, ~ ;,  `, F , F ,  ,  , F , F , F , F , , F , F - <- F - - - - - - - - - D- . (. F ?. D. % I. F k. p. % . . % . . % . . % / / % :/ : s/ F / * / F / F 0 F 0 F D0 F S0 F b0 F q0 F }0 F 0 F 0 F 0 F 0 F 0 F 0 F 0 F 1 F 61  S1  f1  1 F 1 F 1 F 1 F 2 F 2 F E2 F n2 F 2 2 F 2 F 2 F 2 F 3 !3 F S3 F d3 F u3 F 3  3 F 4 F +4 34 F c4 F t4 F 4 F 4 F 4 4 F 4 F 4 4 F 4 F 4 F 5 E5 L_5  d5 Lm5 F 5 F 5 F 5 L6 L6 F [6 F m6 F 6 F 6 6 F 6  7 +7 F Y7 ^7 F 7 7 F 7 7 L7 F 7 F 8 F ;8 T8  Y8 F r8 F 8 F 8 8  8 F 8  9  9 9 F J9 F f9  z9  9 9 F 9 F 9 F 9 F :  : F 8: F: F S: X: F d:  : : % ;  ; % /; 4; % }; ; ; ; ; ; ; < < #< 7< F< F Y< m< < < < < < < < < < = = % L= Q= % = F `> > > > > >  ? ? 6? ;? % m? r? % ? ? ? % ? F @ %@  *@ F 5@ F b@ ~@  @  @ F @  @ @ F A 'A  FA  PA F eA  nA xA F A F A  A F A F A F 3B FB F ^B F qB uvB }B F B B  B  B F B  !C &C F 5C F XC  dC uiC F uC F C F C C  C  D  8D F xD  D F D F D F D  D F D  5E  DE F iE  sE F E F E  E  F F ,F F xF F F F % F F % F : F F ^ F ]^ F o^ F ^ F ^ F ^ F ^ F ^ F ^ _  _ F %a F =a F La F Ya F ja F a F a F a F a F b F b b F b F c F )c /c  7c F Sc F mc  rc wc F c y c F c F c F c F i F Mi F \i F ki F zi F i F i F i F i F i F i F i F i F j F j F j F .j F =j F Lj F [j F jj F j Dj F j } j F j } j F j F j F j F k F k F *k F :k F Zk F ik F xk F k F k F k F k F k F k F k k F l F l F !l F /l F =l F Kl F ^l F {l } l F l F l F l F l F l F l F l F ko Uo Uo Uo Uo F Qp F p F Ir F 6u F v F ov } wv F y #y  { { F { F { F | F A| F c| F | F | F } #} 1} F D} U} F l} {} } F } F } F }  }  } F ~ F T~ F m~ F ~ F ~ F ~ F  F = F  F  F  F  F 5 F U F p F F F  F B F l F F F Ӂ F  F 9 F S   F F F  F L F Z F p F { F F F F ȃ F ރ F F F  F F 6 F  h ˄ F   F - G Y F q F F F F Å F F ( F 4 F I  F F ņ F  o    F   F  F  ^ ' F J v { F  F     F  F  ^ & F A m r F |  F Չ ډ F    F 9 e r F   F ˊ F ܊   F  ( F 4 F A F R d z   F  F + F 3 t  F nj ̌ F ֌    F  * F I F Z   F  F ߍ  F  F F Ԏ   F ' 6 F @ T   F  F F r w F    F ː  F ^ F  F * F f F p ^ } F F F ϑ < F F F  F ) F 8 F E F X F e F z F F F F Ē F Ԓ F F F F  F . F C F S F h F x F F F F “ F ѓ F F  F  F ' F B  R F ^  F F F F Ȕ F Ք F ݔ       #  -  7 A K ]  F  F  F Õ  F  F  7 F K F S   F  ǖ F Ֆ ږ F  F  F  F  F % + F 3 c t F F F F F F ˗ F ח F F F F  F E F ` F y F ɘ F ՘ F F F F  F 5 F A F [ F q F F F F  F Q F F F К F F  F ' F ; F s F F Û F Л F F ( F q    ǜ  ؜    - D  `  s      ĝ  ם      ! 5  F Z  k E    ɞ  ڞ G     $ 8  I ]  k b  X  5 ß  ܟ     E F ] F F Š F ۠  F  F 0 5 F k F z F F F F F F F Ԣ F  F ' , F T F a  ʣ  ϣ mף F F F F F  F * F 6 F E F T F c F Ҥ  פ mߤ F F F  F  F # F 2 F > F M F \ F k F z F F F  F # F 2 F N  ^ F x  F F N F . F F F F  F ƨ ˨ F F   F V F e F t F F F ʩ F F  F Y ~ _ F F C _ F ݪ F  F N  ƫ ի   " F - F 8 F F F U F    x  ƭ ڭ        7  [  z  F  Ʈ F F A F , F 9 N g F u F F F F F F ° F  F  F 7 F S  _ F F F F ͱ F  F F 0 > F L Y F | F F F Բ F ޲  F  F  ' F @ F d F n | F F F F Ƴ F ޳ F F  F . F F F T Hb F  F F ˴ F F  F  F - F < F H F _ F F F  F F ʵ F Ե ٵ F F  F " F 1 F ; @ F X F x F F F ȶ Ͷ F F F  F  F & P F F  F ѷ F ߷ F   F  F & F 1 6 Y; F X } ] F i F u F F F F F F F ɸ F ո F F F  F  F - F = F d s F F F  F Ĺ F ӹ F F  F   F : F D I F X F g F F F F º Ǻ F   λ F   F ! F 9 F Z F d i F F F F   F ! F 0 F H F a F t   ½ F F ( F C N F e k F 1 F Ͼ F پ  F  F ' F 6 F B F `   F F F  F ׿ ݿ F >; F V a F w } F > F F F  F  ! F 8 = F i F x F F F  F F F  F , 1 F @ F O F Y e t F F F  F F  6 F F F F y F $ >> F s F  F  F * F : F n F F F F F F ( F E F c F | F F F F  F  F 8 F T F j F F F F  F 4 F X F t F F F F  F  F = F V F s F F F 3 F F F F F     F ! ) a1 H  M mj  F  F F F  F $ ) F 8 F G F F F F F F  F   F  # F 8 = F R W F f F u F F F F F  F F F F F F    F '  , F R F l F y F  F F  F  F b F o F F W F F F , F 8 F E F W F q F F F F  F  F > F W F o F F F F F  F # F 8 F N F [ F i F F  F   F '  , F E  M F f F  F F F F  F  I  O F n F Q F    F  F   & _ , F D F U _ ^ F w F F ~ F F  F  F 1 F F ~ P F e ~ l F ~  F  F  F   F C F T F r F F F F F  F F  F  F . F T F c F m  } F F  F F F F  |  F 5 F e F F F F F  F F F F ~0 F > F M F _ F u  F F F F  F 6 F X F p F F F F F F  F  F D F O F e j F x F F F F  F  F F F F  F   F #  * F E F n Fs F  F  F F  F   F -  =  ] r F  7 F       F   5  Z #    F 7 F  77 F E F [ F l F } F F F F F F  F 7 F e F F F F F F  F  F  F ( 6 F c fh F r  F F  F F F  F F , F S  X F b  n s F }  F F r  F F  F  F  % F / < F S X F f F w F F F F F F F F F F F F    = F O T  ` F x  F F F  F F F f F  ( - F @ F N @ ] n F |  F  r r r r    F % F / 4 F b F  F  F f F  F # F S fX F b w F  F  F  F $ A F m F  F F F   F F   F ! F 0 F : V F e F t F ~  F F F F F  F ( - F ; F i n F { F F F  F r     F @ F N  S F ] d F F  F  F  F  F  # F 2 F I N  S F j x F F F F    F (  4 9 F C H F l F  F   F  F    F $ Q  V F n F x ^    F    F   F  F 3 \ C P sU BZ F f F r F ~ F F F F F F F F F F F  F  F  F ) F 5 F A F N F k F F F   F r  r , 1 F ; @ F z F  F  F F   F ^  F M  R F \  p r |  F ] F   F ^ F 3  8 F B  N S F ] Ub F y F . .  . F Z F  T  F $ F L  Q F [  g l F v { F  F F  F    F  # F 9 > F ^ c   .   F Z F  T  F  F   # F S F a  f F p  |  F  F U F  .   F  Z  F , 3 TP U F a F n  s F F  F   F   ." ' 9 F J Z O F a h T  F F  F F  F    F ! < A .W \ n F  Z F  T      .+ 0 .K P .f k } F Z F  T F    F  F + F 9  > F H  T Y F y ~   .   F Z F  T  F ( F 5  : F w F    F     F   F  F    F     F " U' F B G F Q UV F   F  F  F    F     F   2 7 .M R f F t F  F   F  ( F   F  F  F  . F * F 8  = F G  T F  F    F   F  F    F    F F  R W F a f F    F  r   F  ] F  F    F  F U  Z F d i F  F  F    F    F ) 5  B F P r \ a F t  ] F  F  Z  F   F   F  r  F  % F 4 9 F P  U F a F z F    F  h  F    F  U  F ) r . F = F O V Tc F q r { F    F F  F F    F (  4 9 F C K H F f   F F  F F  F    F  ! F ? a f F { F F  F   F    .- 2 L F ] Z b F t { F T   F  F ; F I  N F X r]  b F   ] F F  F  F    F #  ( F 7 F A N F e  j F v F  F    F  h  F    F  U F , F = Z B F T [ Tx } F  F    F  F    F     F  F $ F L  Q F [  g l F v U{ F   .   F  Z  F   T # F / F <  A F z F    F     F  K  F    F  F    F S F a  f F p  |  F   F    .   F  Z  F / 4 F @ F P F x  } F    F  U F  r  F  F   T F  r  F     2 7 .M R c F t Z y F   F  r   F  F   F  F  F  Z  F 3 @ F N r S F p } F  r  F   F   F  r  F  F )  . F 8  = F G L F u r z F   F    F    F  r  F   F  F * / F V F d  i F s x F  F  F  F  F  r  F  # % F 3  8 F B G F z F    F   F  F   T F  r  F      " F . F ;  @ F y F    F     F  K  F    F  F    F R F `  e F o  {  F   F  F  F    F     F  U F 6 ; .Q V g F u  T     F  F  F  F  F H F  F  F  F  F   F  F ) = F R m u u  *   s     .    % F 7 F E @ [ t F F F H" F X" F r" F " F " F " F " F " F " F " F # F # F '# F 6# F E# F O# U# F u# }# F # F # F # F # F # F # F # F $ F $ $ F $ F % F % F % #% F 2% F <% A% F P% F Z% _% F n% F x% }% F % F %  % F % F % F % % F % F % % F % F & & F '& F 9& F K& F [& F n& F "' F J' F Y' F h' F w' F ' F ' F ' F ' F ' F ' F ' F ' F ' F ( F ( F *( F 9( F C( H( F W( g( F z( F ( F ( ( F ( ( F ) ) ) = ) F 8) =) F Z) F ) ) F ) F ) s) F ) ) ) F * F * F ** F 6* F Y* m* r* F ~* F * F * F "+ 6+ F B+ F M+ F \+ F s+ F + F + C + F + F + F + F + F , F %, } :, F l, q, F , , F ,  , F , F - F !- F U- F b- F - F - F - F /. F w. F . . F . F / F A/ F k/ F / / F /  / F / F / F /  0 F l1 F {1 F 1  1 F 1 F 1 F 1 F1 F 2 F *2 } 02 F O2 F o2 F 2 F 2 F P3 F b3 F s3 F 3 F 3 F 3 F3 F 3 3 F 4  4 F '4 F g4 F x4 F 4 F 4 4 F 4 F 4 F 5 5 F 5 &5 F 45 F C5 F R5 F \5 f5 F t5 F 5 F 5 F 5 5 F 5 F 5 F 5 F 5 5 F 5 F 6 F 6 F 6 &6 F 46 F C6 F M6 W6 F e6 F t6 F ~6 6 F 6 F 6 F 6 6 F 6 F 6 F 6 6 F 6 F 7 F 7 7 F )7 F 87 F B7 V7 l7 F }7 F 7 F 7 F 7 F 7 F 7 F 7 F 7 F 8 F 48 F P8 F l8 F 8 F 8 F 8 F 8 F 8 F "9 F .9 F i9 F }9  9 F 9 F 9 F : F 1: F P:  ^: F z: F :  : F : F: F : F : F: F :  ; F ; i; F ; 1 ; F ; F ; ; F ; ; F <  < F F< 1 ^< F w< F < 1 < F < F < < F = F <= 1 h= q= v= F =  = F = F = F = > F > F ,> F L> F k> F > F > F > F ? F ? F W@ F A F LA F A  A F A  A F B  B F GB F B  B F B  B F B  B F C F FC F C F C F C  C F D  D F 1D  :D F wD F D F D  D F E  E F =E  IE F E F E qE F E \ E F E SE F E 5E F E F E *E F E F F F F F (F 1F =F SF F bF F mF F wF |F F F F F F F F F F F F F F LG QG F G F G F G F H F $H F CH VH iH F H AH F H F H  I F I F 9I F hI F I F I F J J F +J F 9J F DJ F OJ F ^J F mJ F |J F J F J F J F J F J F J F J J K  K F .K F RK F K K F K F K F K F L F /L F KL F iL  L F L  M F 4M F PM F nM  M F M F N F N F .N F ` ` ga  a ga #a g4a 9a gJa Oa gba ka va {a ga a a ga >a a b b b gb -b 3b >Bb Hb Wb ]b gb qb {b b b b b b b b b >b b #c (c g.c =c Bc gOc Xc `c lc qc c c c gc c c c gc c c c d +d 6d Zd ld yd ~d gd d d d d gd d  e e ge .e Ue [e ce le |e e e e e e e e e e e e 5f =f Kf Pf `f hf vf {f f f f f f f f g g Jg Rg `g eg ug }g g g g g g g g g g :h Eh  _h h h h h i  %i *i g=i 0 Di ] Ii  Oi _i di gpi  vi 6~i i gi  i i gi i gi i i i gi i b j  j  j #j g4j Aj Oj + mj rj gj j gj +k Ek  Pk  jk qk vk gk  k k k k  l  "l )l .l g6l  El Vl  el + zl l gl l Dl Fl % l  l l  l }'m Obm Y m Y m m gm  m m gm  m  n   n  n n  %n 4n _9n Qn  rn wn gn _n On n gn n U n + n  n n 8o }o O'o O,o 9o OIo OWo Odo  mo  to Oo Yo o  o o  o Fo _o  p  p *p 8Fp  Sp [p gp lp F yp p p p p  p  p p  p p D q q  !q @q F`q eq gjq + {q Oq }q q q gq q gq + q + q q gq q gq + r  r  3r :r ?r gPr Ur g`r Flr + ur zr gr r U r r Dr Pr r gr r gs  s 65s As 6Is Ns gos ts gs s s  s >s s )s s gt Y %t  *t ; 1t  6t t 6t  t t )t )t )t )t )t t g!u )6u )Eu  Ju Qu Vu  u Y u  v  v v g\v  lv qv gv v gv  v v gv v g w 1w 6w g;w GWw mw w w gw w gw # w w gw w w g(x  Ix Nx grx wx g~x x  x x gx x gy y g2y >y # Iy Ny gdy iy gy  y y gy y y gy z $z g+z iz  tz yz gz z gz z  z z gz z g{  2{  ;{ @{ gZ{ {  { { g{ { g{ {  { { g| | g2|  a|  | | g| | g|  |  "}  J}  o} t} g} } } } g} }  } 4}  } } &~  9~ 8A~ F~ *L~  {~  ~ ~ ~ ~  ~ 4~  ~ ~  ~ 8   6  A F gi n g      "  B WQ V gj Wy ~ g    N ր +  g 6 3      # g.  9  E % O  g   g   ǁ gҁ ܁  g s  g t . t ? M R g] b gm r g  g |    g˂ Ղ  ݂   F   g  - 6 F E J g^ 0 c j o gu   g  ]   g         P ` g l  s x     8  T %~ ;      Å ʅ υ  f S 4D W d @ y   8  gƆ ˆ gۆ  g  g    # 48 I N gj 4t ~   g    ʇ 4Ї  Շ  ߇ ]    c/ N 6 Y L  V ^ l s x g  " P ̈  Ո    D *  5  H M g[  f  y ~ g P c N ̉ Y Չ     g Y    "% P8 D  M  S  ` Yp x   Y    g P    ) @  J ` p w |     Nj , + B  L b r y ~              / ? F K  R W ^ c   ō Ս ܍      Q [        Ȏ ͎ Ԏ َ "   ԏ      "  ) . 5 : S c j o  v {      8 B Q _ j r  ϑ ߑ        % 6 ^ n u z       ’ ǒ  Β Ӓ ڒ ߒ  [S a s  "  [    I] o   Ô     / 7 C      gӕ ە     l   C S 0  r$ s +  2 9 , @ : G  N U y\ c j q Mx I    /  Q  ` ,  Ȗ ! ϖ    3      M " ŗ ̗  ӗ ڗ   {   " X   < )' - . > 5 <  C 9J 5Q  X E_ f  m t \{  i  Ș   @ ) J kT  ^  h t n {    G   _  y  ș  ϙ ֙  ݙ &     4 3    % # : * $1 w8 B I  g    ;     % 1 N8 A ? S F dM  T x[ b ;i p  w 8~     I  # g   ě ˛ yқ  ٛ   4      $ B  j  Ĝ =Μ  ؜     '      X& \- 4  ; B v I P wW  ^  e  l  s z  y   a z <  ~   Ý ʝ    .     Ǟ ) Ξ 2՞ }ܞ  ;    '  J  j /" ) L0  7 > E  L S Z Ga h o  v  +  ß   o Iv g}  j  k  ? E )  Tà  ʠ  Ѡ ؠ }ߠ 2  Z o k      / %  , J3 = D  b    t  e  ,  3 : -A H  O KV ] d Wk 7 r ,y {         N  vƢ p͢ Ԣ ۢ   $     =  e  i R ɣ 4 ӣ ݣ          p! ( / G 6 = CD  K VR $Y W ` lg R n u ,|   d }   )    ܤ   "  ť ٥   Q  9 8 > O &m  &զ 5         < L S X  _ d k p         X 3r         ʨ Ѩ ֨  ݨ     f 3! 1 8 =  D I P U n ~       ũ ҩ    f & ; i          ! ( - E U \ a  h m t y     S% - )5 < A FY 5h  m 5| H 5     Ĭ ˬ Ь          : B ^ n u z        ­  ɭ έ խ ڭ      & 0 J Z a f  m r y ~        Ʈ  3 & - 2  9 > E J c s z      ȯ ϯ ׯ ޯ   $ [5 1; L G b r y ~       ư ˰  Ұ װ ް  + 2 : A I P X _   w˱   1 L   0 7 <  C H O T m }       ɲ ٲ  b@ R k  cų e ڳ    M i b Ǹ ٸ        # 3 : ?  F K R W ` e  l q x }        ù          / ? F K  R W ^ c       " ) . F V ] b  i n u z      Ȼ ͻ Ի ٻ        & + H w        ļ Լ ۼ      - = D I  P U \ a       Ľ ɽ      % , 1 e u |      ; ݾ       " A Q X ]  d i p u     ƿ  Ϳ ҿ ٿ ޿    . 5 :  A F M R w         3 3, < C H  O T [ ` y        + @ i v           ! & ? O V [  b g n s  3 # * /  6 ; B G ` p w |      #   E 3f v }               # 2 B I N  U Z a f                $ + 0 c  |               & + 2 7 U e l q  x }              0 @ G L  S X _ d     1 A H M  T Y ` e     o                 U e l q  x }      .  d u         ( 8 ? D  K P W \  8         8# 3 : ?  F K R W }                e 8 8           "  ) . 5 :  8               $ ) Q a h m  t y    8             % * P ` g l  s x    3         " ) .  5 : A F o 3                 t 3                t 3                t 3                U Y x          A 3 A G W ^ c  j o v {   c        ; mM ] d i  p u |   n         / 6 ;  B G N S x            $ )  0 5 < A g w               $ + 0 V f                  C U y  -   8  8       * 85 :  A F M R g $ 8               . 5 :  A F M R z X X      & + 2 7 K [ b g  n s z   X  ) z                 $ + 0 6 = B H O T Z a f l s x ~                 8 B H R Z ? l |                7 G N S  Z _ f k                 + ; B G  N S Z _       " ( / 8 N ^ e j  q v }          8 > I R X d m                 ' 7 > C  J O V [  ^      O V ] p                 2 B I N  U Z a f   V ^ F | F  ) K 8   m: # aT a a a a9 a` a a a    X ` l    a  '  ] e q         ! @ H T  t |   g g #  w a a k 5 C      ,  z F  a C z >  H Z a a& [d [   # z # 0 # y F  # G L  i o      a3  K [   H  P i H a   ]  l l  8   ) I M T x     M  a B ) ?    U  U y   U  ?   ?  ? ! ? 3 ? O U u    ^    A p     0 0    0 , ^K ^] ?    D   U Z 0    0  r    ^, ? < ? [ v     D#  V ?  ^F ? ~ a    a o  '  O e  } o   a ^  "  O  v ~        " 8 h      ( aZ o d         C ao a       F $ , 8  H F X F         a> Z av      0     N V b   X       a   a  a  L T `    a  a !  !  !  *! ^! ! !  " 0" V" |" " " ? " "  #  9# R#  b# B z# a# #  # a# F $ $ ;$ aM$ F Y$ F $ F $  $ $ /% F S% _%  m% F % %  %  & .& G&  n& & & &  & ' 1' J'  q' ' ' (( 7( `(  (  ( () I) d) ) ) )  *  J* * *  !+  d+ + + + + + + 3, Y, u, , , , , , , , , , , , -  - - -  - '- .- 5- <- S- X- _- f- m- t- {- - - - O - - - O >. E. J. O t. {. . O . . . O . . . / O / $/ )/ O ./ H/ R/ _/ l/ / / / O / / / / O 0 I6 T6 O k6 v6 O 6 +6 6 O 6 6 6 O 6 6 6 O 7 7 O +7 67 O M7 X7 O r7 }7 O 7 7 O 7 7 O 7  7 7 O 7  8 8 O 8 8 O 9 9 O ; ; ; = = O = = O > > O > > O ? ? +? ?? N? b? q? ? ? ? ? ? ? ?  @ @ /@ F@ Z@ i@ @ @ @ @ @ @ @  A $A 4A @A TA dA uA A A A A O A A O 'B 2B O IB TB O kB vB O B +B B O B +B B O B B O H  H 8H CH O I +I I O J J *J 5J O ZJ eJ O cK +oK zK O ML XL O oL zL O L L O L L O oM zM M M M M M M N %N O N N N N N N N N 0O ;O O VO aO O |O O O O O O O O O O P #P O PP [P O }P P O T T T *T O 4T BT NT YT O cT wT  T  T T  T  )U 4U O >U QU VU ]U dU kU rU yU U U U U U U U U U U O W W O W W O W W O Y Y O -Y 8Y O IY TY O eY pY O Y Y O Y Y Y O Y Y O Y Z O Z *Z O AZ LZ O cZ nZ O Z Z O Z Z O Z Z O Z [ [ O 7[ B[ O `[ k[ O [ [ O [ [ O [ [ O \  \ O '\ 2\ O N\ Y\ O u\ \ O \ \ O \ \ O \ \ O ] ] O ] ] ^  ^ O )^ 4^ O P^ [^ O w^ ^ O ^ ^ O ^ ^ O ^ ^ O _ _ O +_ 6_ O M_ X_ O _ _ O ` ` O .` 9` O P` [` O r` }` O ` ` O ` ` O ma xa O 2b =b O b b O c c O 9c Dc O e e O e e e e O e e e f O f f  g g g O g g O g h  h h O =h Hh O Yh dh O Ji Ui O i i i O i i O j  j j O 'j 7j Ej O hj sj O j j O j j O j j O j k /p ?q Jq O hq sq O q q O q q O q q O Gr Or O r r O r r O s s O 1s 9s O t t O t t O t u u O 0u ;u O Ru ]u O tu u O x x O x x O x x O x x O y y O 0y ;y O Wy { { O | | O 3| r}  " O @ K O f } 1 < O Z e O  O   O X c O   O „ O ߅  O   O # . O I · ه O  O   O J U O s ~ O  O È 7 B O L Z p { O    O  O U  *   O  O ׏  O S ^ O  O  O 0 ; O  O P X O  O ) 4 O   O =   O ' 2 O M X O i t O  O  O Ι ٙ O v  O  O  ( O  O + 6 O M X O  O œ O ؜  O  O # + 6 O S [ c n O {   O  O  # O    O ў ܞ O  O f q O   O ş  + " O @ K O i t O y   O ˠ O  O   O & 1 O H S O q | O  O  O ޡ  O   O 0 ; O N Z e O |  O   O Ţ  Ѣ ܢ O  O   O u  O Ƥ O  O  ' O W t  y    ʥ      0 H  M  Y k   Ǧ  Φ   &  +  7 I  u  ܧ     ) 1? L J z   #   8  @ n    g    + 1 H? I [N Xb k s [x X   6 Ī Ѫ  #  !  4 r T  ج    A R c     ˭ ح       # M < M x    k  ' 2  : Q  d  |   f °   P \     N Z  в   E X }   { ^ Qj  Q   9 {} QƵ cI c Qƶ  7 7 7  7 > G R w    7 7 ͷ gط g 7  7  & + 2 7  E 7 L 7 U 7 ] 7 g p 7 x }  7  q   7 ĸ 7 Ը 7 ܸ ]   7  7  7  g" '  / 7 ; 7 C 7 I .] ] r  { q       ܹ  "    # 1 [C Q a 8 h o 7 7   Ժ 2 2 2 21 ? M [ j {   | K 7 ǻ 7 ӻ Bٻ 7  7  7  7 7 . UH  N  X a B    I ɼ ; 7 U C ) BG 7 R 7 \ e  n q v  L     9Ƚ  ӽ         4 7 ? 7 J  S q h L 7 7 7 7 7 7 7 g ¾ ʾ Ծ .ھ 8 ߾        a# L* e / 4  9 @ JO  T Y  _  y  }  *       * _ ҿ  ٿ  ߿ a  L  z  a      ' _ , e 1 Q c $ j gs J  e  z L    *    * #  ( / JC S * [  m y    *   e z L  e z L!  , A * I  R d  k Jy J   *  J     *  % J/ * 8  G N S Z _  d * j v }     *             *   % J-  9 @ E L Q  f n g{   g  g   g  g   g  g   g# * g7 D J gR Y gf s y g  g   g  g   g  g    / = S _ Z g Uu q   q F q F   q  F q 3 F: d ~       w    - @ S      L     (  I  j     8   +  ; xT  m  u  8     9              3  8  Q  V  o  t    8              5 D \       U ?  D Q i x M        M / G d  i    6  ;  I  N W o  M     @  E        B R xs  x       $ 4 xQ  u        3  I  f        M 6  t   ( -  2  H  h x x    0 X x         H   $ {. %8 ? T F hP W  ^ %e  l ~   z W M x (   d       " >, 6 ?@ ; J  T ^ =h  r y   ? 6  B V    p o z    X  "  9 4V  v        M 7  u      x #  W  r     3 h        c G G      ^ }     8     2  7  O  T  o  t             %  *  /  H  M  R  Z k  p    8            8 =  B  S m  r  w         . p x  8   G    G   & . e      % D U     M M    ; _ d    1  [ ~       / e     ) x1 j     '  F  S ; d  ~      x    ( U        H  { %  T  h $  + %2  9 ~ M ~ \  f p zz W M x (   d        >  ?! ; +  5 ? =I  S Z  a  k ?r 6y  B V V : f  v  o  I  [ s       ; M ; xX ` q x x ! ! a x r  a r T      u6 f /t /    /  ;     ) / ; C  m e e     U      d ! S @ A X r x    S A     <     | G zy z x x o  4 d  1 l D  h e e   e  O      {     x u  x    8 P ^  l   A   x S  % <, -1  D  e l w   l        $ . 8 YB L  S Z d < k  r y  W W    u     Z      t     ' v. RB RX  b l v  H    { %  T  h    %   ~  ~  y u  y    7  7&     x z     g u        9 G  }         I W          Q _      ! +!  a! o!  ! !  ! !  -" ;"  q" "  " "  H# s# x# # < #  $ $ ;$ P% b( (  ( ( ( vj) ) ) x;* vG* L* * * * * * +  + l 1+  A+  + + + + + 7+ + 7i, w,  , ,  - +-  a- o-  - -  - -  -. ;.  q. .  . .  . .  5/ C/  y/ /  / /  0 0  E0 S0  0 0  0 0  `1 1 x1 2 2 !2 +2 D2 u J2 2 2 2 3 x#3 -3 A3 27 @7  y7 7  7 7  8 8  M8 [8  8  9  A9 O9  9 9  9 : e: s:  : :  : ; g; u;  ; ;  = x>  >  > x> x? @ @ xA x0A xA xA A B B B C 7C C 7C C D CD C E CRE C^E E F E F %F xwF F xF xF F  G xG  ;G NG XG %bG rG  I  J -J  FJ  _J  xJ  J  J  J  J J J K M K M XK  iK K  K  K K  L  L 6L  nL L  L  L  L  L  L  M  M  'M  ,M YM  ^M  wM  |M  M 8 M M  M  M  M  M  M  M M M  N  N  N DN  IN  bN  gN  rN M N N gN N g1O 9O g]O  O  O  O O  P  KP dP P P P  P  8Q YQ pQ Q Q  R  R t"R V  [V  xV  V xV  V xV V  6W PW hW W ;X kX sX X U VY  kY {Y Y  Y Y Z )Z GZ  QZ [Z eZ oZ H yZ  Z {Z %Z Z T Z hZ Z  Z %Z  Z ~ Z ~ Z  Z [ z [ W[ M [ x*[ (4[  >[ E[ dL[  V[ ][  d[  k[ r[ [ [ >[ [ ?[ ; [  [ [ =[  [ [  [  [ ?\ 6 \  \ B\ V@\ \ o \ \ j]]  o] j] T]  ]  ] A^  F^ Q^ `^ tr^ M z^ t_  _  ,`  K` q`  ` ` x`  ` `  a /a  Sa ia  a a  a  a a xa  b x"b  Ib Yb xzb b xb c Uc c c c  c 8 c d (d  0d Kd  od 8 td d d  d d  d 8 d  e 'e  /e 7e 8 o  Oo lo yo o o o o  o o p p 5p Ap jp  up M p  p M p i q x8q  @q KJq  Qq aq qq K{q  q M Yr  ^r qr r r r r r  r  s s +s >s Vs `s s  s s s s s  t ,t  7t M t  t ut  t u u  7u Mu  lu  v %v =v Nv  qv  v v v  v w  0w Qw gw  w w  w w 8 w  x )x  1x 7x Vx 8 [x nx x  x x y y ~y -y y U y y  y 8 y y  z  z z t z t z t z t z m{ }{ { { 8 | |  :| J| xk| {| x|  |  | | |  } )}  3} =} G} Q} H [}  e} {o} %y} } T } h} }  } %}  } ~ }  } } z} W} M} x ~ (~  ~ $~ d+~  5~ <~  C~  J~ Q~ k~ ~ >~ ~ ?~ ; ~  ~ ~ =~  ~ ~  ~  ~ ?~ 6~   B  V% O ` 7  o   F  a π {  O  T a p i M i  .  : KN  q     È  4  9 J  a h z M B: 9 x     ;  l  x    Y g      % 3  i w      5 C  y   ː    = K    ő ӑ    M [      8 F  |   Γ     H V    Д ޔ   (  ^ l  ڕ # xH xf  ?   ?N j     1 x Ϟ ؞  W z     (  d r      0 >  t   ƣ    @ N    Ȥ ֤    H V    Х ޥ   "  X f      $ 2  h v      4 B   x x<      Y    ګ   )  V ( n ( ( ( ( Ь ( (  ( 4 h (  ( (  ׭ (   2  @ ~    ֮  / # < U n  /ί / /B /_ /s   /  Ұ    + w    (  x" ( 2 xS ( c x~ ( x ( ֲ     7 S ( ( ( ( "ϳ   4 ( K ( S "c v     (  ( ' ( ? ( G "W k }  ϵ    " 9 { ( ( ( ¶ ( ڶ (  u& 6 uV uo  uƷ ( ݷ ( (  ( & ( > ( F  w  w̸ ( ܸ w ( ( $ ( C ( \ ( t ( ( ҹ ( ( (  ( 2 ( J ( R Һ c p c  P K k s T  @ļ    T P ? P b c } c c н c  T  2 P [ {  c ߾ K (  c 2 B N U a : ( ( ( п ( ( c , c X Vy ( (    $ E ( I c c c  c , c D c   ( x# ( 3 xG  [ o   K   7 c T c l c c c c c c c  c , c < S ( _  t y  x     ( 0 ( D X  l      c  c . ( K [ u ( (  ( p  v  l 2 K pq l  3  Z } | } } 4    A w    >  V     . 6 N U e q V o     " . D t \ f  p  z S       x q f e A t    '  1 S; E O Y c j q xx q f e A t ( ( # = e o  y    F k  v  &   e  / ? xO c     S       x! q( f/ e9 Aq ~{  i  h   , '    n    ~) 3 i=  G hQ  [ e , o 'v }   n      S      ! x( q/ f6 e@ Ab t          0     % , o3 L= xV '` j t ~ "   0 3     ? '  !  ' I f |  v p l  3[  o    E V e 3k l l p l  l  l  I  I ) a c c  I l w ~  1  ^ 7 \  c  R I d c  c  c ' c G a c  c E c ` c x   c    ' , L   c c  c ( c H \  }   c     / ( L Q ~ ( ( c c  f ( @ ( E  g m c c  c / c P ( h ( r     r L     m" ,  1 c L c c  c  c $ > c ^  c  c / 4 U Z {     c  c = d c  c     c + 0 A a f  (   ( (  c 4 c W d ? | ( (  g " c C c k c c c ( ( D L X  `  s }    ? : ( T ( h  p  c c c c (   x8 H xP m  u  c L   c   c . K c k  c  c  c 4 D  z c       )  N jk p     c   2 7 ] ( z   c c c c   ( > N xn         G g w x  j j  3 g Y c z c j  8 jH  j } % } B } 0  ^ w      &  ; G  _ s        #  : W       x    0  Y m      x    2     'Z    ) _      4   } 2 2   % - a t & V L o V r )    )   )  ^  @     Q( 12 < F P tZ a h r 2y 5  t n     )     + Z k  s  z I |   N x x> N S Y V l Q    . <  Q |     7  75 x C C C C 2 F  F d x x   x 5 < g x x x T  xL 5 \ xk p    .  w     = K  ~     @ N     7 < H e   t   n! C' 2 { a       " + N ~ x    1       #             ( 3 8 = F T [ s a   r r r  K        H     8   NS t      B  W.  J  ]  m xu C  C  U Q    M j Z  R! ^! F! !%!  /! 6! H =! CG!  N! g U!  \!  c! ||! ! 8! b ! !  ! !  ! J! ' ! !  ! v ! ! J! #" e " 8" o " " SR#  # # # #  # $ $  "$ M *$  % %  &  F& T&  d& & &  & &  V'  ' '  ( ^( w( (  ( x5) F)  )  ) x* %*  y* h* h* x+ + L, x|, 8, , , , , , , , , , , - -  - - -  - 3- >- C- H- P- ^- e- }- a- - - -  -  .  #.  +. 9.  @.  H.  l.  r. .  .  /  D/  p/  /  /  0  40  `0  0  0  0  $1  A1 j1 x1  1  2  :2  h2  r2 |2 {3 3  3  3 x*4  :4 xc4 x4 x4 5 5 5  5 6  G6 x6 C6 C7 Cd7 Cp7  7 F 7 F 28  _8  o8 x8  8  ?9  l9  t9 Z9 x9 j 9 x9 g 9  @:  P: xx:  :  : : Z: x: j : x;  ; g 7; N; X;  b; w; C}; ; ;  ; W; ; ; 7,< W3< ;< 8w<  < < 7< @ = =  > h> h\> 8>  > h> C>  > h>  ?  $?  -?  Q?  X?  b?  ?  {A A A A A B bB B B B bB SC aC  C C  sD S {D D D D D D D  E E #E +E ;E 1 CE SE  [E kE ^ sE E 7E E \E E E F xF &F FF ^F c vF c F F c F  F R 8G c G G G  G #G G  G G TG G 7G H AH c zH H H H c H c I 3I ;I I c I I c I I c J 7J c WJ J c J c J J J  K ( (K ( BK UK aK oK K K nK c K c $L c QL c iL c L c L c L c L c L c L c M c )M c IM aM ( M M  M ( M M L M M  N  N N  :N MN  rN xN N  N N N N c N N "O c DO ]O  O O  O O O c P "P 6P VP [P P ( P P P  P P 3Q g YQ c zQ c Q c Q c Q c Q c Q c R c /R c RR c lR c R c R c R c R c R c vS c S c S c S c T c T c 8T c PT c hT c T c T c T c T c T c U c =U c UU c oU c U U  U U V c 9V >V RV rV wV V ( V V V  W  W (W ;W  cW iW |W  W W W W c W W &X c FX cX c X X c X X c X )Y ;Y PY VY \Y Y c Y c Y c Y c Y  Z c Z  ?Z WZ c oZ c zZ Z Z Z Z  Z Z Z Z Z  Z  Z 0[ c P[ c r[ x[ [ c [ c [ [ c \ / Z\ c r\ c \ c \ c \ c \  ] c ] 0] x@]  Z] ae] p] o] c ] c ] c ^ c ^ c 0^ c H^ c `^ c x^ c ^ c ^ c ^ ^ ( ^ ^ &_ ._ F_ ( _ g ` ;` Q` s` ` `  ` ` ` 7 ` j ` ` a  (a Da Ua a a c a b 'b 6b `dhl ptx|"$f  įȯ̯Яԯ  (08@HPX`hpxİȰ̰а԰ذܰ  $(,048<@DHLPTX\`dhlptx|ıȱ̱бԱرܱ  $(,048<@DHLPTX\`dhlptx|IJȲ̲вԲزܲ  $(,048<@DHLPTX\`dhlptx|ijȳ̳гԳسܳ  $(,048<@DHLPTX\`dhlptx|Ĵȴ̴дԴشܴ  $(,048<@DHLPTX\`dhlptx|ĵȵ̵еԵصܵ  $(,048<@DHLPTX\`dhlptx|Ķȶ̶жԶضܶ  $(,048<@DHLPTX\`dhlptx|ķȷ̷зԷطܷ  $(,048<@DHLPTX\`dhlptx|ĸȸ̸   $(,048<@DHLPTX\`dhlp tx|Ĺȹ̹ йPԹعܹ_W + ^((@D6 Hn LPTX\`dhlptx| `m ĺOȺ ̺}к ԺغMܺM   o 1   ,b  $ (,0J 48m <p @ D H L PTX \ `[ d< hX lpXtB x|C   $^  C Ļ Ȼ̻3л=Ի* ػ ܻ"DZx  $,4<DLT\dlt| $,4@DHLPTX\`dhlptx|`lx  $(,048<@DHLPTX\`dhlptx| $,4<DT\  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx| $,08<DHPT\`hltx (, $(,048<@DHLPTX\`dhlpt $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx| `dhlptx|x| @DHLPHLPTX\`dhlptx| $(,048<@DHLPTX\`dhlptx|  $(,048<@D (,08<@HLPX\`hlpx|  (,08<@HLPX\`hlpx|  (,08<@HLPX\`hlpx|  (,08<@HLPX\`hlpx|  (,08<@HLPX\`hlp 08@HLO P`p  (,0@P`p 0@P`p 0@P`p 0@P`p 0@P`p ]$](],]0]4]8]<]@]D]H]L]P]T]X]\]`]d]h]l]p]t]x]|]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]^^^ ^^^^^ ^$^(^,^0^4^8^<^@^D^H^L^P^T^X^\^`^d^h^l^p^t^x^|^^^^^^^^^^^^^^^^^^^^^^^^@_D_H_L_P_T_X_ f$f(f,f0f4f8f c 4JLYbxDqK% ~B P@4 szy  =`&% < N y x` W Xr   @"  s* G  ( p   K  b C ) 06I ] j [ v x  &  e    b  }& D " ܔ* p@ T{m '# U  x s E f  _ 9>' 0B > 2Q Q` )D v  '  8 z  w/ 7 y e'' 0" ^91 w0A J N -_ p~ \\ w/ ' V }Z  B hS c`Ih?-iG 9 PY ^f |vA9 .d@^[.-- D X (& q=PH6URRu.y38`EfD8du)0)7G UL*~S`;rF~ o  0Y}x v0. W;Hx7~e`qt t H'm  XcBL <pbgS(`F; ET|!vP,Y. H x`e1> JK X `plt' U ]w@ qH /! 4L M)^u,h@vK 1ii } dz @F#P% 5 /BV CebpԽ h Z X  ~Zko!b @` 4O) K/.@EQw\ g@u%W > /y`YZx kt6!2A/F/+jz~-z;H. =_I  @W = <t 3Eu3Z;C+`Z ix& {`J i?=d b2+B `P1 /\uNg/{9 _`  Fx   f % =L,l:(|8X4gN |eKU H   X#!2rJLGlcu*(s 1`,+FyP$% 3 J ^0cLmXo8 K %NA#} +-Z {CS uY#x1& 8C xc!S3u Ib@0 yȪ k + 2h /+ dAMt #S g@{#I&6, QTzOu / , /  9 ]# h 9 EL }` v   g  xVU E <  KQ  !b  !0!M ;! L!&-a!5SVv!!v!O!u+ C!!n[+!m"+ " " 0"TKSA"Q"f\"̀ k"" ">u"PC":"@O"$T,""@#6#x-EL#) W#oc#V.{# ]#X ##t#s#]j#I $ :$3$a E$NU$2 @n$$I+$oc$j 9$g> $ڣ$8 H$V %'- %#.%D% Q%%$a% :u%%~*% %+%-&%@%,%p&`,&٪'&/&@ B&`}OJ&`d&xu&&&& :&&@@&OY&'!& '.',0' <'. 6I'm'%x'}'~} 'x %']I !' 'VW '-U,(q E@(A0R( Vf(u(U(j*(((:(`(?b )y)}T))a0)B) T)z`)@t) ))0)), ) *B23*~I* @\* m*f*0`*x **b** * #*ym+a +So+"HB+P+a+fv+1n+N ]+# +f+v+'+> ,+,>, 2_,< hv,,z\,A2,@,)-7 -Bx0-19>-H-E?a-U5p-N -@J-ps-- -$--3D  .U !._1J.u \.'c.`Q4.Y .[ _. /.0?. .' /;& B/2/,G/]/$.hf/ mz/, /[c/m /vT /r&/0!/ Z 0J0=z'0xl>0'T <Q0q`0br0@00b 0fS"0# 00qN0G18 N51 M1 ]1Y h1~1B1)111 1; 2X 2}32 D2A.\2 Dk2@ 2G2 <2%S2n 2YP2%. 3 3E %3 ,:3B .O3|^3.t3 p3p3; 3ND 3f 3Vi H3+3| ?44SI ,4C48N40 *u[4j b4/q4)y4f444ZW5d 5 :,5653LA5J V5 g5l h~55) 5P5%5s 5 56a!6( 76w(G6KB#w6l6_ 66L 66616'y7]+'7_17?7$tNN7V\7o k7Vv7n7A17d77H 7$5717b8 8!-8H!>8%P8o= h8@ +z88~O8ƣ:8F8ʪ B8 888# 9929D9D \9 n9 pq9 9j )9$ 9 !9 99t9z:Ƿ : +:E @:0 [:q:~M::a:Cy:::a :@3:|q&;,;f8;gx kO;%Z;ŭ-n;GH; ;,; y;;e ;$Y ;-&<+<-5<TF< qZ< $ e<EC>t<8 <V< <F ><k<I <+, <]+  =ӯ ='= :=E=kX=Dm={ =P =u\= 3= =G===  >>b Z2>J_>c :u>>8 >> F>~>y>N>ک ??&,#?3?C?< V?)G??@???wm?f b?5?  @*!'@6?@/ O@r 'b@ +}@P #@A( @ @WLj@@<@D@{YA 5"A,A"?A NAb dA/yAA' A(mA;AABB9(^(BI @ByOB̐fB }BBu3BqB& B.BzU B4C 1Cd ,CyHHC\CO{CzCC`XC|C-< C} CC /CW D>%8D~Q 1HDXWD9nDP3D.ZD D'D^Y D DADnP #Dp T E $E# l(E3 DFSTOF%fF8FEOF0 wF( FFzF%_G_$GfWLG<iTGu_GpJ#mG;_ -G8G@ GGG@jG@ G G<hH"H 6HDHYCMHOaHYuHU2Hp!HH HeHݶ H >I$"I2C 1,I DIVI dI8 aIlIII%I (I7ZI1I UIJl+J 6J GJ_ bJpJd?JI6JJJJ7J:W J.N K K^ 'K '7Kb DK_[K 2oK\KLQKLaK[`vKK@1KvNK`K7N L%L? ':Lf ZHLIA^LJ 6jL CL L L mLi*LLL& M(Mfo(M<?M3SM2qMM <M QMM> M>MpMƮtNN &N@7NPN^NH/EoN'QNK+NhUN?H NT N@iNN4N O l5OD!KOI ^O /vOPO OfrOǵO=OmO" [Pc %PR)P' 0P:,CP SP a fPػoPh PQBP0-P PbxPaP*Q~OQ#Q U2Q!LQS$]Q EnQ֑lQ5 ZQQv QQo?Q@QR!R ;R aER93 QRp$gRxR1 R RX iRRVR FR S St98S UpUSUU\UtVdYVen3V>VMV4_VlVV V  wVG$V*V VWl&W9WY KW}sWW[WhOWT >W)X< X^XG ,XvvCX IXloqX vXQ X0 'X6 ZX XrX&BX@XT  YxY$ .Y9S EY #]YBDpYԧ}YYfY!qY 1Y_ xYlZ(Z 5:ZkGZ SZmaZH rZ$> ZhSOZ jZ\ ZLfZZ:Z =[Z 8+[@:[% R[%c[ Bw[[ [}+[ [[R[S [( \"\? U2\ '?\IW\"n\w\ \Wl \4\7 \2 \,v\l]]]O q1] uK] Z] x]7#!]]R ]E] l] ^Tm^ .^sI^ U^= i^^ ^jT^=RR^ 5^s6  _y3_.,_<_eQ_Pg_& _ !_ g_ _]._c y_n r_Q  `i A2`P`djGh`x` `5` ` /`RS `PTW`a@aT 3)aT =adXa rae aa[a a fVaPBaCaW a }bb%b  3bCb!Qb@hb'Vwbvb4bB Vb5* db&nT:nKnJOVndsn:(n)nn' nnznsn <o^o )o5 9o LoV(co@~ voT oi!oo moKos oo24p !'p;pMpZp pajp53~pHpNb pCpEepS,pqGJ A(qF5qϰ Mq $`qC oqNf}q q) q8*q ` qP q 9mq rT& ryr f0r)a0FrOWr;' br qrr trkrrv r8r&"sD1sU,Jsssq!ss_s=Hs DscFs PtB tt3 ,t;:tFt n wtZ VttVTt tatxtr u G"uE /u;>GuYuxeu u Zu u uZa%uS uBu vl v9vN 'Mv bv,iv}vv*ovwO v jvQqv vv v vM  w@\(wII =wP5Pw:~jw8 1|wJeww4{w w! :w wԡA xV xm1xwBxKQx`x @vxoExsaxPxT xxYx x  ya y/|7y(nKy)byڲ yyybyS"y' y tzxz@Y"z9 0z6% Ez[z#uzm6zAz,zb z@.z8z!'{ .{*u,{7{I{ h^{ }{ l{ [{T{ {6_ {@`{B|/1 E|@ |/ /|?|^J|oW|iq|1 #|N|' |!?=| |3 |~N |}/}3d<}fg?U} q} Z}x9}/D}U};=h}j L}/}}`  ~ ~ .~- F~ gQ~k~t~~~M p~>~xu~[*_ #e;t'Sd7w5QеcSy - /O  z8 k,@XDY]8o@J z@j<΀- t9 ` /$)P 1HZ% ~\J|P: = Ɂ( =߁[k ic_. =+EQ9JbBw\( v5U,Ղgye c  .")8RW er z~cfO =U σ8;߃@?^ ;H=R tM a u^d }UuDŽfք> ^' D`PG:+FNJ{nSWplb'v _ $= Dž ,݅Y ә (AAAf;aT%sVxsnSdžj\% 5,M-4ar &"[qnxƇ4# чW Qއц ;-I(@ P-ʀ<Qi}R   Lj.܈%%*;v6XixbI6 % ɉ 0 h }$?E%p2.J WlF' T` = Š .ϊ* ڊ % 34>>kaaq8=2  1 ϋ (BwPe c6I )H5eVmB'`b wNx n%S&( ӌΧ gD "->dH%@Z+q(y C2> E- M+41 Df8 2_vt#u6cT ѱ   B̎k)(v/y)O];h@GJFc3dΏ ԏ , @  (@>M_[iNzx3D8 w3Ȑ@֐ j B P;)6Z3(>1,DG3LqldYqqh yh= ctV ?ÑLޑ[cR ~~" 5U.L 42WM n   bȒ?]ؒDxa_% <O"\7K _ uls_H wv`< ͓~ ,6j*I kW 1=Kcg 0mEM {Ô,J֔  .D( " H15` FV ]54 p J|u 5 Cnϕ}ڕx `[ CU2 Lu~m>'Ζ5ݖ @dA!'> OC kf +~I Y4 n՗ n, # "=8I `xYr7 )c}@,U O1kWəޙ9g8 EL*!*b1 N}}]mmT MK I Fp0f,+~:A/gt  e ˛=:^  * <;uNaf^Y,7c ft' 'f\C@P  '˜jqr z hs c2*S` e ~m ' D4d̝@7 m %H -2\ KAY .NY%ks +q+-  q @R Ԟ < S 'J(;7 H 7[ hq@p^HGm  ǟ\ݟ )-d  7  /*I 9DUj=j< ~A?%&E-Ġ ڠkI > :^kG :PwjyU% ,>+jY7i̡ ~ߡW  o{ ? %ijD=k X; e iou Nx  J_0͢PG֢[ .D څ Ff/AO Z8]8kw7 7A %^ l6 9ңVtܣD I4I w+<&99 PO]j zZt/mn¤GO Ҥ /ݤx hK+ *KXVm#] ~lmB g1d^2 P̥Ѽ n @ < .NP S7txJXptu /m  oC2ߦY  9`- G. QI d-z ^N" |˧_ <ާ^gdA,b5(Fw9jUJaHYdbr `  TèШE (0 >I#<whP+ rjN7| =)]C'ϩrک2 bRd/@- ?jP :`y tCG$HS  ժZs X aQ+ '=rGLfa ]aUGm2 /ڬ d6׫ QQyA0Yo;PL]~oLx\fZg1f_ άPW ̾ klZ/T@ \h}\bѬ Eʭ> 7߭"6- s+8Y8QE .eh{p \ q:Ů^ٮ<:<l  Q # 4 NrYn~,k 1@ ICϯH1Y1U h+184U2G:V h z6H ! ? H/ϰޞUڰ %- C ]l el |< ~O (ű -Ա(^XJ7 H+`}IN\'p | 1 !D ˲S"dv' s]%oM/"JST a w{ -w"B ³ ֳ  4[,lI<R<G Vi #e\+v[&A3xH& ɴ!% ݴ>d "s ;1F WQ l ft$|-=LC!ʵu _ٵcD 5b  RS( V3T>XN}Pg x+L5 x6 ֶH1=[U ^s\5B`Sb tX \"` @@tշ/ +ժ O+,B] X*1^ ǩt& e ȸ e߸ \'~ 70&b 9} D :QI;d Gy bJ4չE 4G  #JJ0% QaU` r !)e6ĺ ׺c`ZՋGT;1 d %iV4E Mh3axw k0&˻UJֻpWc/8 0 }%{3-z 9Hg #YiMjC&O|XD HnB u ɼJ !  <fUx#sG6nKco}bT]D Xȿ  S ;@%.;' Pap   gWʟ#k;,TTKH ` Ei (?&5?F @aJ9W>S mY hR )ZR $Z 3_Ip^w hQ1 i\_8 M@A X (B_2@U"ou L* ]%-]!U@@Nc 3 VA -Kg!fmPpu 3`  .*nW ZP UVa%>Nqz\-@j }e<3 n!KF_  ( P78 Mа Pd wS @y   9zg/^;( * K -,"QY:X e2Zx;3j _Hd Mӓ @[.G  "{_4J'BP?k] s !.NFIIi a`+2aG~!-+'yQRDt#!+x-#a awk'( :]( HU bv < !u$bk5Ϩ _# 2'r2@GVcU}el  3 uq6  A,6 c1RBZGud P$ lK g) : #{1 F#`_i%,s, 4 )= S [#Q k -UK3kn0+ bj O E-  @@Wc%(F :Yd yPBnAq-rE  v19;I >.` o;o Lؑ MW_:j S jeD 3j  b" *5%IXaCv ?0&ϴ p$ 0bE N K0{ 1?]&Fi6 >{<vhDb ]n +#@ \P b Rq *Rq h e!u .`+B ZU( i}rn Q [,ACI  1NHpJ&Se_ !zmlI`].+] xc5u8"t1 H^?^% EmstXZ `SD Q L: a ' 4yJHZ -i {sP(  EV\ }P )v= = Ob|e_sS~ 7 W *S D,@%m;n TH+lb ' j^Vˈ I !te "6.Ar)Wq|e\z163AT%a:"1 5&E +-D @xQXihCt-x-DBc &Jl:i H=VQcp }XbЛ[tO~\[ d<  NV. LDdt1 s2x{! W_5 .Y G<$ uPlr7~0= Pc ] =MZB<( 'f@ ?VF( ]joHq #Ev`b]R, `W !1` IOgu  c * =kA v,/LYxSjsh, =n@< /"C#%x <5ωX."k T&` Ya`s^! :V ( J9 hSA fu # |DG  s-Y"5b,< A S(* @a<')z|UOIH =O  O&t9 74>hYPJ+Y'jzL j U3(@n K *F 8-:G&@Xk[i }Pu %fp/dM, >* ^  n6 mX,7_G [v) H o  & =U13 _W.D nf#7 TZiA qO@@I,db< T&_cah |<XmZ}cD P 2"-:V_aP-] jyPF )8_F  .0Yo {aJ @@(~:K J Z. w<@WGu?[nn/ ) !    + pYWC:Z? ox;2  pv d |v 7# <CWS`>qiGMmJp &9gi!\!X '. 9 QE ue v<1 Qg0ci :G\3qc o%5B1`hw9BZ8d oV . +G< [HrDi+ ! i #]p QM, dV 2FNo-=!H\[s+,7  W  &+>">\yxB Jz3 S tN ^k <&f( K( m. 7\'EXvzu= K zf,%I Az %v !< K\ |q~I  n[^h1BT m_ #=` nO cvfhD `+CԨ  @&kO~uu0/<U ]rk}VX7G.  % *K heQp  + ,.Q@ h_  -k ':d Q!0o> ~h N]J V1˥a*MI a #7 I%C _b 2s ]b>  lUH_I @Ft Oe 't* Qhedtlw1|,   &)n  B0@R(A^ W_k{{  nX 7 je%\8 ;l:o Ge#"w, wPO=9^Gy~Y40% B;FY] Jm@z²ʨ #p J 1) uK=*x,xB ; "Gy2^ 0TT_ + ELRT^ "<jZ}&piaK@N ;=/ D#`\=wxz> MS  .=Pg ; g@!Y.6 tGcx0ܐOO to0,<KV}KMF( V5 $li j9x 72amS>LPW e Prĝ,?qZ a=dY J o@ pC!PD`bmd+w\DviyqG+ W (8l VTkx ay(yRGX r]*y 6+#w_ 7@G ALs[.w4S n4 /  /'c%>'> Uws} /;Ls&{dC . G= Hy b N1 K 4@  f\ y* <e g)7   P   d&   v kp ~1 .; UkG [ h `^x  M 3  0 P  a V i 9   ;' j  D ȇ7X e  z DM Ώ      1 Hb  -$ @>6  iC CO < jl 1w @ 9  D )    W # A M #$ D5 )#T Ml Tw :6  O  -0 V" ^  "`/,F |@h* c }cf+ PM +< ` k4C)U;wt:P nBDt`07)Ert"Ъ=/D XPzjew -&O: ' c!oS ! 'kSj,SXı Sox u1 Cs 0doCi.65;LIRĴ5e\ kz92F +[b83g##7cGO X= #1;yECUax.LC4.LC26.LC135.LC136gbufGetAthV22ModulatorLowFcFIRCUsbStartTimerModeFaxFRM0TimerCAzlIntelTimeElapsedV34TxDataSetPendingPatternV8RcvReturnMenuSignalDataCAmrViaCheckLoopCurrentAutomoderReportModemSignalLnxTransferCodecVerbsLXPrintDebugBufBlockShort2LongMoveg980HzCoeffsV27DataPumpSetRxModeV32DataPumpRcvMainV8bisControlQTSDetecteddp_modem_command_longV34ConstellationMapTableV34P2ControlRxDetectFirstPeriodicalStateurb_completeClearHaDataSetSRegisterRangeCmdA3PolRingDetectedlinux_modem_closeV34Phase4TxSendTRNPart1StateVoiceRxTimergpUsbQueueDataMnpSendLAV34P2ControlGenerateINFO1aDataCAmrALiOffHookV32TxDataInitLXSoftModemIndicateDialToneV34EncoderSetTrainingModeModemGraceDisconnectPPPolSetHookV92TrainingEncoderGenerateParitygTotalsamplesreceivedCAmrViaCancelPMStateGetLineDetFlagV22ControlXmtBytesNeededSoftModemGetShortManufacturerNamecall_funcCallProgressMultiToneSetParamsCAzlIntelIntExitFTHHandlerRICmdgPlayDmaBufferAC97SLabsVerifyCodecIDV34P2ANSpcmRcvResetRBSPowerLimitMinRateV8bisXmtInitCUsbStopBlockLongFillRequeueTxDescIrpLXModemRegisterMCRChangeLapmDetectorStartGetMseMaxCUsbDisableCallerIDV90DataModeDecoderSetRateRenegotiationModeCAmrALiReadRxPositionio_dte_rx_sptrV92ClientControlSaveV92ParmsCAmrALiConfigureCountrycCoded16800MapgSoftModemBuildDateStringV22FrontEndAgcEnabledSL3026SpeakerLXHardwareBottomHalfwDspCore_pTest1SetServerIdV32FrontEndSetUpGainMSCHandlerCAcadiaIntEnterV34FEECInterpolationDisableCAmrSisDisableCallerIDlin_pci_dev_get_base_io_addressV34DeMapShellsPCMClientFrontEndSetLongNeecDisplayBlackListCmd2EchoCancelSetRefDelayPSSHandlergV32NominalEqCoefTablekOrigineDonneesStringlin_pci_dev_is_doneAC97SLabsA2EnableCallerIDV34RxDataV44DecoderPutCompressedDataprintkLapmReportErrorV32DataPumpReportRateSignalCSV92PPStatusHandlerAC97ViaWriteGPIOCUsbInitsetMercuryGainAmrSisAudioPresentV34ConstellationDeMapTableCAmrALiSetPMStateIdleRxV34PhaseJitterInitV8bisXmtDataHandlerV22DecoderSetRatedp_read_dsp_regCAmrALiCancelPMStatedp_dsp_regreadMercuryDisableCallerIDV32PllFeecGetPhaseErrorSpeakerphoneSetDuplexV27EncoderInitU2PolSpeakerV17SetGainAndPhaseEstimationModeCAcadiaEndTimerModeV90ClientControlResetCAcadiaEOIPCMUtilBuildOneDemapMnpInfoSMDataModemInitget_urb_transfer_dmaBlockFullPowerV22DataPumpConvertRatedcloop_old_stableUsb_LowerArmClockCAmrSisSetPMStatenegative_eshutdownILSDHandlerSmpModemRxDataHandlerV16550_IRQ_NumberV32PhaseJitterResetCoefVDXHandlerLoadDefaultProfileCAzlIntelEOIV8bisMainInitUART_CopyDteTxDataCAcadiaInitV34NonlinearCompensationXmtGainresetResumeCallBackUpdateEEPROMTALSHandlerV16550_InitV92ClientPhase4RxWaitRiBarStateV34P2DPSKCalculateCRCCSV92PPQueryPMStatex_elapsed_timeIdleAudioWriteSL3026DisableCallerIDV29EncoderInitV34IEECInterpolationEnableV27DemodulatorSetModeV34P2ControlOrgRxDetect1stPhaseReversalStateV29ControlCleardownRequiredgLongProtocolMessagesDataModemCommandHandlerV34P2L1L2EstimatorsInitV29DemodulatorEqAdjustUpdateGaindp_download_dspSaveActiveProfileV34DataAssemblerInitBlockByteMoveUnalignedkUnknownTypeStringFaxIDLESnooperPerseusEnableCallerIDget_endpoint_packsizeread_vuart_portPciCfgWriteWordV34MainPllSetPhaseUpdatePaceV34PFeecStartCheckATCommandStartCallerIDOnCallWaitingV29ControlXmtDisplayWhiteListCmdCheckDataModemLoadSignPatternMerGain1PPPolDisableCallerIDPCMClientRestoreneecCoefBufferLapmSendSABMEV32ScramblerRemoteV8MainRcvV8bisControlReceivedFrameErrorV32DecoderSetRateSL3055EnableCallerIDLineMonitorCmdGetSLevBlockCplxInRealCoefFIRV27FrontEndInitm3_per_initio_at_esc_seq_detectedx_strcpyV8XmtSetModePciCfgWriteByteATCommandRestartModemAfterCallerIDOnCallWaitingBlockShortInterpolateWithIncrementBlockShortAddPCMClientInterpolatorSetClockOffsetVSMHandlerPerseusShutdownCodecCAmrIntelEOISL3026ChangeHwConfigV34TrainingEncoderResetV92TrainingEncoderSetSuEncodingQ14ATPutsgV34PPPatternV34P2ControlAnsRxDetectINFOMARKSStateV34NonlinearCompensationRcvGaingV34BlankPatternV34P2ControlAlignTxBlocksReportHardwareConfigurationx_le16_to_cpuV34InterpolatorSetClockOffsetCodecDataInitV34InterpolatorSetSlowTimingOffsetUpdateGetWorkModeFaxIDLE0TimerAutomoderModemSignalDetectorV8bisMainSetGenMSFunctionLXRegistrySetValueNamegShortCompressionMessagesInternationalCallProgressResetFramerAsyncRxGetConverterdcloop_ydiffV34TimingOffsetRecoveryResetGetLinearValueDLAB_latchV92ClientControlSendSequenceCptCpProc1lin_pci_error_to_errorFramerRxV34ControlCheckClearDowngPtrStoragegrayToLinearRealFFTCAmrSisOffHookGetServerIdLapmSendBRKsmdDspCore_dpPatchUART_initio_dte_rx_rptrV32InterpolatorAdjustTimingOffsetV34P2ControlGenerateINFO1cDataV22DataPumpReportTrainingProgressLonggpUsbDevExtensionModemIdleRingFrequencyDetectV34TrainingEncoderInitGetBetterFlagV32DiffDecoderx_task_queue_initx_atomic_decPPPolSpeakerFramerSyncRxMerLiteConfigureCountrykAnonymousStringV34P2L1L2UpdateEstimatorsLXSoftModemUnchainStatusHandlergAudioBPFQ14CAcadiaCloseV34P2ANSpcmRcvAdjRBSOffsetlin_error_to_sys_errorio_dte_tx_wptrVTAHandlerV8bisRcvGetMsgTypeV34TxDataEnableScramblerATProcessorWriteLapmStartgV34TimingOffsetRecoveryLowBandCarrierSpecTable8KHzgetActiveDebugProfileSRegV92EncoderSetBlockSizeCAmrViaEOICodecDefaultWatchdogHandlerSetCleanDataFlagwDspCore_pTestLapmSetOwnBusyU2PolShuntControlUART_dsr_offlinux_debug_messagePciCfgReadWordAnswerCallLXRegistryGetFirstValueMnpRleDecAC97SLabsA2ShuntControlCallProgressMonitorV90ClientDataModeRxStateFaxAnsTimerIdleAudioReadResumeCallBackV8BisRcvHDLCStatusHandlerV34Phase2SetRcvModegV32OrgSupressorCoeffsBaseAddressSqrtMsePowLXHeapFreeg1800HzCoeffsLXModemGetTXBufRoomAudioSetRxDataHandlerUtilAdjustComplexMagnitudegUseBulkLLDumpCloseV90ClientControlSetDataModeUpdateGainsVTRHandlerGetHaAdptMseV34DataParserResetV34ReportAdvancedConnectionInfouLinV90TrainingDecoderFinishDILDecodingV32EncoderResetV92FlattenVarsCDefaultSpeakerLapmRxCAmrSisEOIV16550_baudrate_updateStartSAMLinkV8RcvSetModeLXSoftModemChainStatusHandleruSTblUART_CommReadCountgetInternationalCallWaitingFreqLapmProcessTESTATProcessorCountWritePendingCodecReportLineSettingsV22DataPumpReportStatusPPPolVerifyCodecIDV42bisEncoderInit_PDMV22DemodulatorInitgCopyBufCntV34ShortP2ControlAnsDetectPhaseReversalStateUsbWriteGPIOWithMaskLoopbackTestCmduss_read_bulk_callbackBlockFwdRetrnUART_cd_offSaveNewDilV34InterpolatorInitU2PolSetWakeupStateV90ClientControlCreateJaCUsbEndTimerModeV8XmtDataHandlerV34ShellMapperInitSoftModemAuxRxDataHandlerCDefaultClearTxBufferSetConverterStreamLXSoftModemUnchainEyeHandlerV90ConvertMToKV32DataPumpReportConnectionInfoV34FrontEndInitGOIHandlerStringSizeV32DataPumpXmtInterpolatorV34P2DPSKXmtPerseusCheckLoopCurrentGetMaxLevV90ClientControlInitVarsMercuryConfigureCountryCUsbReadRxPositionLapmGetAckPendingDataModemReportModulationATProcessorHookControlBuffersWriteFrameV29DataPumpRcvV22CorrelatorInstallUsb1AndS1DetectorV34PllFeecUpdateDataModemReportClearDownGCAPHandlerV29TxDataInitset_dev_read_urbCallWaitingDetectorV22DataFillBufferpUsbDmaBufferSoftModemGetMemorySizeAC97IntelCodecWriteaLinRBSPhaseMapATProcessorCommandHandlerMessagePartitioncCoded7200TableV32TrellisEncodeDataAutomoderControlInitV34TrainingDecoderSetPPDecodingVCIDCmdCDefaultCancelPMStateV34InterpolatorTweakTiminglin_pci_dev_enable_ioCAmrSisReadTxPositionV34DemodulatorSetLongEqualizerV34FeecPllSetPhaseUpdatePacePCMViterbiDataRecoverySL3026ConfigureCountrygV34SbarPatternATCommandCallerIDRingOffBlockDotProduct22V27DataPumpCommandHandlerSPFHalfDuplexerTempDisableUss_JustSetWorkAroundV92ClientDataModeRxStateATCommandCallerIDResetV34ControlExitDozeModeFaxModemReportClearDownV92ClientControlCreateJalrnVRIDHandlerget_dev_bulk_in_endpointAddrSoftModemStatusHandlerV34NonlinearDecoderMerLiteChangeHwConfigLXHardwareCanStopAC97ALiCodecWritePPPolSetWakeupStategV25SupressorCoeffsV34TrainingEncoderromDspCore_SMMLiteSL3055VerifyCodecIDDialingTimerUART_dsr_onV22DataPumpReportConnectionInfoUART_ri_onModemRegIn8board_enableV8RcvDataHandlerMercurySetWakeupStateCMDetectionSnooperV34TxDataSetPatternBuffersTxFrameHandlerV32InterpolatorInitgPCM2PCM6dBPadV34P2ANSpcmRcvInitLLDumpDispV92DataModeEncoderParseCPDataUART_CommFindByteUsbMerDebugCommandIMAADPCMDecoderSoftModemGetBuildDateio_esc_dte_wptrdp_dsp_isrMercuryInitCodecLapmReportTestResultV34Trellis64WalkBackBuffersCountWritePendingV34NonlinearEncodergtztestSL3026RingDetectedmemcpyBlockLongSubtractV34P2ControlTxPeriodicalAndTerminating10msStateSilabsSetHookV8RcvCDefaultEndTimerModeV92ModuloEncoderx_restore_flagswDspm3Fdspwrap_uss_probeMnpAsyncRcvFrameHandlerio_dte_tx_buffV90TrainingDecoderResetV27TxDataInitAutomoderStartModulationTestMainV32TxDataSetPatternagr_inplgV34Trellis16TerminationTableV34CoderUtilSyncCodingParametersV29TablesCarrierValueVGRHandlerV34CreateMPV32DataPumpReportTxRatedp_int_regreadSL3055DebugCommandV22InterpolatorEnableFastTrackingwDspCore_pmeV32PhaseJitterInitV32ControlDetermineRateV32TrellisWalkBackio_get_dte_tx_countPCMClientNeecDisableIdleRxDataHandlerV32ControlResetAC97SLabsA2StatusHandleruss_control_callbackV34TrainingEncoderEnableDiffEncodingResetBackRetrnCntLXHeapAllocAudioWriteFlushV25Generatordp_regreadV34RateCompensationRcvGainSPFPowerThresholdStartTxFlowControlMnpFramerStealTxFramegHandlersMapcCoded9600Tableio_get_dte_rx_countagr_outpwV32EncoderInitCUsbEOIV90ClientPhase4RxWaitMPStateSPFHalfDuplexerIsRunningV22DemodulatorIdealSymbolPtrwDspCore_PdmDPV34PllInitsmdDspCore_pHomoV32HandshakeSRCRcvGetGainspectralbitEnabledgtzInitV34FrontEndAdjustRcvDelayV34RxDataSetIdleset_dev_bulk_in_sizeReportCmdU2Addrdp_in_portagr_pci_get_irqg600And3000HzCoeffsFskRcvSetCarrierLostThresholdDisableRDLRequestgMessagesMnpReportConnectgPCMRcvIIRPreemphasisCoefsdp_test_cmdlin_timer_msV34PhaseJitterCancellerCommitUpdateV22PllInitPCMClientDataPumpCommandHandlerUsb_StartIsoDmaSilabsCheckLoopCurrentCAmrSisStatusHandlerLXHardwareInfoCreateLXModemPerformRXClearV90TrainingDecoderSetSSbarTransitionDetectorCAmrALiShuntControlBlockMapByte2Bytewait_for_core_writewDspCore_pCoreV32ControlErrorV34InterpolatorSetFastTimingOffsetUpdatex_ms_delayV34Phase2SetXmtModeV22InterpolatorBigTweakV34FrontEndResetPowerIdleStatusSnooperV27DataPumpInitgtzsubBlockSetAtduart_dte_tx_countCSV92PPCheckErrorPrintCPHeadgTwiddleFactorTableCSV92PPReadTxPositionV34DataParser4DSymbolLoopPCMClientDemodulatorPredictorCheckQualityx_MOD_DEC_USE_COUNTAC97SLabsConfigureCountrykill_proc_wrapV34TrainingDecoderSet16PointTRNDecodingResetDefinitionTablesdp_write_dsp_arrayV16550_Write_MCRPCMClientNeecDisableUpdateBlockBkRetrnAC97SLabsInitCodecV32FrontEndRcvGetSrvALawMnpQueueMergex_wakeupCodecGetSregV92ClientControlStartTxDataModeSetAthFskXmtV90TrainingDecoderCalculateDigitalChannelGainlt_init_timerPCMDataAssemblerV32DemodulatorUpdateV34TimingOffsetRecoveryResetFiltersAudioPCMInitCUsbEnableCallerIDBlockLongCoefFIRUpdateV90ClientControlRcvLapmDiscardDataV29FrontEndInterpolatorV34P2L1L2ComputeAndCompareSNRFaxModemReportRateV8bisControlReportRevisionNumberLXRegistryGetParentKeyV32DataPumpReportStatusV34PhaseJitterSetUpdateGainV34TrainingDecoderSet4PointTRNDecodinggV23OrgSupressorCoeffsV34PFeecSetMediumUpdatetimertick_functionV90ClientPhase4TxStartSStateV22RxDataInitx_vmallocAutomoderReportClearDownFaxFRH0SnooperLXSoftModemChainLogHandlerBlockLongCorrelateEBHandlerV27InterpolatorBigTweakSilabsSpeakerV34PhaseJitterSetDelayio_dte_tx_countPerseusSetWakeupStateCAmrViaChangeHwConfigV34TimingOffsetRecoveryBackupClockOffsetSetBlackListEntryPCMClientDemodulatorSetEchoOnlyModeFaxFRM1SnooperKeGetCurrentIrqlPerLiteCheckLoopCurrentdp_init_modemBuffersRxResetV8bisControlTxFinishV8bisStateV8bisRcvInitSL3026EnableCallerIDV22TxDataSetExternalHandlerV32CorrelatorSRCInitV34MaxSustainableRateLapmInitCAzlIntelSetPMStateU2ResetEnumerationLEDFLOHandlerUART_start_breakCAmrSisCheckErrorV22DataPumpReportErrorV34TimingOffsetRecoveryGetClockOffsetCAmrIntelOnHookLoadAlawSetNewLineFlagValeBlockRealInCplxCoefFIRCAmrSisTimeElapsedGetLrnTblIndexIdleStatusHandlergV22bisEncoderConstelTableV22TxDataStartSelfTestread_eepromFAAHandlerVIPHandlerV34RxDataJDetectorV22ControlRxCalculateBaudTimingStatePCMClientDemodulatorSetShortIeecCAmrIntelShuntControlCAmrIntelEnableCallerIDV16550_Read_SCRU2InitGpioDisplayDelayedListCmdMnpQueueInitV34InterpolatorSetVerySlowTimingPhaseUpdateV32InterpolatorSetTrackingPaceCSV92PPSetWakeupStateCSV92PPStartTimerModekOriginePrioritaireStringV34DataModeEncoderInitDTMFDigitXmtInitV34ConvertTimeToSymbolswDspCore_SdVecgV34SubsetConversionTableComputeNormalizedSpectrumCAmrViaTimeElapsedV34P2ControlOrgRxDetectINFOMARKSStateCAmrViaRingDetectedReSetLLStepLapmReportConnectCodecModemCloseVSPHandlerCallerIDReportStatusV8bisControlFinishedV22FrontEndRcvV34ShapingFilterResetdp_board_disablespkrGainA3PolStatusHandlerPerseusShuntControlV8bisControlRxDetectACKStatex_usb_stop_dmaV34DeMapperPPPolStatusHandlerV22InterpolatorInitCAmrSisCheckLoopCurrentx_usb_alloc_urb_kernelGSNHandlerStatusParserstrcatgSoftModemShortManufacturerNameStringSoftModemInternalXmtInterpolatorV92DataModeEncoderInitV32FrontEndGetMagnitudeScaleFactorSPFHalfDuplexerStartFaxWaitBeforeIdleTimerCAmrALiIntExitUsbCodecWritex_toupperPCWHandlerMerLiteVerifyCodecIDV16550_Write_SCRLXRegistryGetNextValuex_ioremap_nocacheCdisRegWriteV32DataPumpConvertRateV27CorrelatorLXHardwareUSBBottomHalfCodecEnableGraceExecutionV27PllDemodulateV32DemodulatorSetUpdatePaceANSamDetectionSnooperSaveRbsMapShortV34TrainingDecoderSetSpecial16PointDataDecodingV34P2DPSKXmtDataSetModeCAmrALiCheckLoopCurrentx_usb_alloc_urb_atomicCDefaultChangeHwConfigx_pcibios_write_config_dwordParityStripV32PllDemodulateConverterGetNumBanksRcvGetFwdThrwDspCore_dPopDebugStatusCmdV42bisDecoderV253ReportRingMnpEnqueueV34P2L1L2DetermineRateBlockMapByte2ShortDispDmInforPCMClientDemodulatorUpdateVocoderWriteFlushV90DecoderGetVoiceRxGainQ4SetServerRetrnCntV22ControlRxDataStateV34ControlErrorEnableRDLRequestSmpModemReadFlushATCommandCallerIDReportCAzlIntelIntEnterOCDetectedSetWhiteListEntryV32TrellisDecoderSmpModemLineHandlerRcvvxdPortOpenLXSoftModemPerformTXV22ModulatorInitV34DemodulatorSetIdleModeBuffersInitx_usb_fill_control_urb_txusb_endpoint_haltCAmrIntelChangeHwConfigLXRegistryCleanupxigLinRequestRegionFlag0CAmrALiStartCDefaultCloseCUsbStatusHandlerLastRxPosSoftModemInternalCommandHandlerV34FrontEndResetGainV22InterpolatorTrackTimingV16550_Read_MSRUART_parityMerLiteShutdownCodecATCommandCallerIDRcvActiveV32ControlSetDataModeATProcessorCountReadPendingV34P2ANSpcmSetRcvModeGetAgrConstV92ClientControlRcvForceRetrainread_offsetCSV92PPStartPCMModemSetCodingTypeV42bisReportStatuspci_base_address_space_ioAgereHAInitUss_InitChangeClockCmdV22EncoderMnpReportDisconnectV34TrainingDiffEncoderV34XmtV34ReportAdvancedTrainingProgressCleanOldDataagr_inpCAmrALiIntEntergShortProtocolMessagesFramerReportFramingStatusV90TrainingDecoderSetTRN1DDataDecodingV27RxDataGetVoiceTxGainQ4UART_CommReadStringVSDHandlerBlockShortMultCDefaultCheckErrorV17GainPhaseHitEstimationInitSilabsDisableCallerIDPerseusStatusHandlerMnpComprEncCAmrSisRingDetectedV8bisRcvGetModulationStringlin_isr_releaseTestConstCodecGetTextStatusHDAStopDmaBlockCplxFIRUpdateSpeakerphoneAudioXmtPPPolChangeHwConfigFlowControlCmd3LapmProcessXIDCodecReportAudioHardwareFaxModemReportErrorPCMViterbiWalkBackV34TxDataPatternGeneratorV16550_Read_IIRgPCMAlaw2LinearNoPadLXSoftModemCleanupV34ShortP2ControlOrgDetectPhaseReversalStateAC97AzlIntelWriteGPIOPCMSlicergV34B1PatternSoftModemGetDCOffsetV29DemodulatorAdjustEqualizerTimingV92ClientPhase3TxInitStateV34PllResetCIDCmdx_elapsed_time_longx_usb_free_urbAgereSlicerbhDequeueOffset_MnpPrintQueuesUsbMerRingDetectedV34P2ControlAnsRxDetect1stPhaseReversalStateEchoCancelProcessInitDictionaryV34P2ANSpcmXmtx_usb_control_msgV42bisEncoderFlushCodecReportHwIdStrings_MnpPrintQueueMercurySetHookV29DataPumpCommandHandlerATCommandProcessorResetx_output_deinitAC97SLabsA2SetHookCodecSpeakerphoneReadAudioV8XmtInitSL3026DebugCommandCodecStatusHandlerFlattenCommandMnpDiscSPFHalfDuplexerResetV90TrainingDecoderCheckRBSMapShiftUsb_FullSpeedStringCAcadiaSetPMStateBaseValueSmpModemWriteFlushCAzlIntelCloseSoftModemGetRevStringV34PllFeecRemodulateio_uart_msrLXSoftModemUnchainLogHandlerBlockRealInCplxCoefFIRUpdateV22ModulatorEnableGuardTone550Hzx_request_regionPCMClientFrontEndResetV27PllUpdateLapmClearExceptionCAmrSisConfigureCountryV34ControlInitV34PhaseJitterEstimategPCMRateTranslateTablegRateTranslateTableV32PllFeecUpdateV34P2L1L2PCMCalculateSNRSL3026CheckLoopCurrentQ24PerLiteChangeHwConfigV22DataPumpLoopback3XmtAC97SLabsA2VerifyCodecIDCAmrViaIntExitPCMInfidelityEstimatorResetV27InterpolatorInitV22DemodulatorCoefUpdateEnableV27TxDataSetModeILRRHandlergShortCarrierMessagesV34FrontEndRcvA3PolChangeHwConfigSL3055RingDetectedU2CmdUART_cts_onV8bisControlFinishedXmtSignalV22ControlEnableLoopbackAutoRespondCAmrSisIntEnterwDspCore_pHomokOrigineInconnueStringFIRFindCoeffSubsetFwdReTrn5822kVoiceCallStringMnpFallbackInitLXModemCleanupCodecReportErrorV34DataParserInitAC97SisWriteGPIOlin_pci_dev_get_base_1V8ControlInitUsbCodecWaitGPIOV34DemodulatorResetV32FrontEndEnableNearEndDelayEstimatorMercuryStatusHandlerBlockLong2ShortSubtractgV34Trellis32TransitionTableV34RxDataSetExternalHandlerCAcadiaStartV34ReportTrainingProgressLonggtzCAStestV34DemodulatorSetFullDuplexFeecsALinA3PolSetHookdcloop_y1Mu2ATblFMRHandlerReportConnectionStatusV22ControlDisableFeedbackUpdateSMLoadInitSL3026InitCodecCallProgressMultiToneGeneratorInitPCMClientInterpolatorRestoreV92ParmsGetDataModeVarianceSetFastRetrainFlagbulk_patch_v121_romV34P2DPSKXmtSendPhaseReversalAfterNBitsUpLevelV42bisInitV29CorrelatorCAmrALiCheckErrorReportInBandHookStatusMerLiteStartgpCodecFskRcvInitV22EncoderInitSL3055SetWakeupStateMerLiteCodecWriteV22ModulatorHighFcFIRV34DemodulatorSetShortEqualizerCDefaultTimeElapsedEchoCancelEndRealIFFTV32TrellisPrerotateV34ModulatorSRCInitV34RxDataSetRiDetectorV29ModulatorInputPtrV34ShellDeMapperCDefaultStartTimerModeV17TxSendGapStateV8ControlXmtCodecTranslateCountryCodePCMClientDemodulatorEqlInputPtrAudioReadCSV92PPConfigureCountryMnpFallbackEnablegUsbDmaBufferATCommandCheckCallWaitingEnabledV32DemodulatorResetx_cliV34FEECInterpolationEnablemain_init_perseusVLSubLongV34DemodulatorCommitUpdateV34Correlatorx_pcibios_read_config_dwordTxDataHandlerExNT_SUCCESSkOutOfAreaStringLXSoftModemChainEyeHandlerMnpQueuesInitV34ModulatorEnableV29DemodulatorAdjustEqualizerGainGetRateset_dev_bulk_in_endpointAddrV25FaxGeneratorLXModemPerformTXBreakPerseusSetBizarrosetMerLiteGainCAmrALiChangeHwConfigV34P2ControlXmtCAmrViaStartSPFDelayLocatorProcesslin_pci_find_devicebulk_patch_v121_flashReportILRRSetAgrConstFlagSelectSRegBitCmdV34PhaseJitterClearInputcCoded19200MapSaveDistFrmEstsmdDspCore_McVecMnpQueueLTFlushV34ControlSetLocalDataRatesCodecChangeRingStateUART_SetRxQueATCommandOfflineTimerVocoderInitMerLiteItnShuntControlwrap_uss_write_bulk_callbackUART_get_statusAssignTablesPatchesV92EncoderGetDataFrameSizex_virt_to_busx_isprintV90DataModeDecoderInitMnpComprDecLapmTxDataFrameMnpSyncRcvFrameHandlerV34PllGetFreqOffsetV34P2ControlGetRcvINFO0LengthCAmrIntelTimeElapsedlin_pci_dev_get_next_matchV22ControlInitiateRetrainUsbMerInitCodecSPFCorrelatorStartGetDataConnectionSetupFskUtilDemodulatorset_dev_udevCAzlIntelGetTimeV34ModulatorInitVoiceModemCommandHandlerV32ControlRcvUtilMaxMagnitudeLapmSetExceptionGetRcvMapDemapV34P2DPSKXmtSetModeVGSHandlerCodecModemLineHandlergV34PllCarrierTabledebug_timerV34Phase2ResetXmtDelayLinegV34SymbolToBitConversionTableAC97SLabsShutdownCodecV90ClientControlErrorSmpModemAudioWriteV8bisControlMRdDetectedV34PhaseJitterCancellerEnableV8bisControlReceivedUnexpectedFrameStorePhoneNumberCmdETBMHandlerLapmProcessFrameRejectV90DecoderResetCodecSetPMStatememsetUlongPCMUtilDecodestrlenMnpReportParameterCDefaultGetTimeV32DiffEncoderInitMaxLevelCDefaultQueryPMStateV92ClientModulatorInitV32DataPumpReportV24CircuitChangeCUsbSetPMStateAdfEncSortFreqTableHangupCmdV32HandshakeSRCGetRTDelayV34RxDataInitDataModeunsolTagLXHardwareStopFskDataPumpCommandHandlerV34FrontEndResetCAzlIntelOffHookV34PhaseJitterResetDelayLineLXSoftModemInitVoiceModemInitCAcadiaCheckLoopCurrentV32FrontEndInitBuffersTxResetgV27InterpolatorCoeffSPFCorrelatorEndSPFRampingAttenuatorStopAC97SLabsCheckLoopCurrentV27TxDataDecToStringV34DataParserFillLoopromDspCore_McVecCSV92PPCheckLoopCurrentV17GetCoarseGainFactorCAmrSisInitRequeueNumIrpsPCMClientFrontEndRestoreV92Parmsio_get_dte_rx_charAC97SLabsA2SetWakeupStateCAzlIntelInitBlackListingCallSucceededV34TrainingEncoderDisableDiffEncodingV32DemodulatorGetSNRLXSoftModemDestroyIdleTimerCAmrSisOnHookUtilShortShortAtan2V29ModulatorInitV34Phase3TxInitStateCAmrViaOnHookV32TxDataV34ReportV24CircuitChangeDTE_initPCMClientInterpolatorGetClockOffsetV34DemodulatorSetTrainingModeV34P2ControlGetInterpolationDelaytblMnpAckXmtV44ReportStatusMerGain2SilabsDumpRegistersLapmReportDelayDisconnectV34PhaseJitterOutputPowergpHardwareCAzlIntelDisableCallerIDA3PolDisableCallerIDlucent_init_modemConverterGetNumBanksXmtgModemOnHoldTimeoutTablePCMViterbiSearchIMAADPCMSampleDecodeV34FrontEndXmtAudioCountReadPendingVoiceModemRcvV92ClientPhase4TxSendTRN2uStateERHandlerSaveResultReportInBandV24StatusV32TrellisSearchV32DemodulatorRateSupportedCptCpProc2V90DecoderInitStartCallProgressgetHDAStreamx_pcibios_read_config_byteFramerHDLCTxCSV92PPReadRxPositionLapmProcessREJPCMClientFrontEndResetBandEdgeIIRSoftModemGetHybridDelayV22ControlRxConfirmLoop2TestUsb1StateV34PllUpdateromDspCore_dpPatchPPPolDebugCommandV90TrainingDecoderCheckChannelInversionV32PllGeneratePhaseAnglesV22ControlTxAnsweringWithS1StateLapmDiscardTxDataV8bisMainReportA8RStatusSoftModemInternalSetupDefaultSampleRateUsbMerConfigureCountryGetOddTE141HandlerV34P2L1L2NotchDetectorszBufV34P2DPSKXmtDataModifyLatestINFO0AckBitpassCDefaultConfigureCountryV8bisControlXmtLXSoftModemPerformTXFlushCAmrViaStopV32PhaseJitterResetSpeakerphoneLineRcvITFHandlerCUsbClearTxBufferGetDataModeStartTimeUART_stop_bitsPerLiteDisableCallerIDV8bisControlCReDetectedPCMClientClearTapsV34MapShellsV90ClientPhase3RxWaitSbarStateSPFHalfDuplexerProcessgSoftModemFullManufacturerNameStringSmpModemReadFrameSilabsInitCodecV34TxDataReenableScramblerSmpModemSetRefDataCSV92PPSetPMStateMnpInfoResetSilabsStartLinkLayerInitVocoderReadFlushUsbMerSetHookV29SetGainPhaseStateAC97AzlIntelCodecReadV8bisControlInitBlockLongCoefFIRV34ECInterpolationEnableaSTblAC97AzlIntelReadGPIOV34P2ControlFindPeriodicalSamplesToBeSendV29FrontEndRcvCAcadiaConfigureCountryV27RxDataSetModelucent_detect_modemMRHandlerdp_read_any_commandConverterGetRcvFIRCoefCAmrIntelStopV22ControlRxAnsInitStateV17GetFineGainFactorlinux_modem_cleanupLXLogDeviceLogHandlerwDspCore_RAMPOPV16550_Read_RBRV8bisMainRcvV90SpectralDeShaperInitV22DemodulatorInputPtrx_udelayV8RcvInitCallProgressMultiToneMonitorInitATPutsWithParityV90DataModeDecoderCUsbQueryPMStateMohDTMFDialerStatusHandlerPCMInfidelityEstimatorUpdateTableRestoreCmdAC97SisCodecWriteFramerAsyncCommandHandlerio_dte_rx_buffV8bisControlGenerateDefaultMSLapmPutToQueueV34P2ControlRxNearEndPeriodicalDetectStateLXSoftModemStopBlockShortClearUnalignedAC97AzlIntelCodecWriteCDefaultSetPMStateFskUtilModulatorgCountryDescriptorTableV34PhaseJitterUpdateEnableTRESHandlerAudioCommandHandlerV34Phase2ResetRcvReadPointerx_current_time_longV34P2DPSKXmtDataInitV92TrainingEncoderSetRuEncodingV8bisControlRxFinishCLRThenSendCLMSStateA3PolPulseDialDigitreg_34mV22DataPumpReportRxRateATProcessorReadSPFDelayLocatorResetV34RxDataSetJDetectorPCMClientNeecSetMediumUpdateCodecRetrainVoiceTxSnooperlin_timeval_get_fastBlockShortScaleDownCAmrALiEndTimerModev253SetSilenceDetectPerseusConfigureCountryV34P2ControlCalculateAccShiftForL1L2RcvSmpModemSetControllerOnlyModeV34P2DPSKXmtDataPutBitsBaseAddressDataCDefaultInitV32FrontEndAdjustBufferDelayCAmrViaDisableCallerIDUART_cts_offPerLiteDebugCommandV32TxDataSetLongPatternBuffersRxFrameHandlerg2225HzCoeffsVMODEM_Start_TimerMercuryRingDetectedSpeakerphoneCommandHandlerSetInitParametersForLinuxCodecModemOpenget_iface_descBlockShortScalegPCMPadTableV32DemodulatorScaleDownCoefStringCopySPFCorrelatorResetLXModemPerformTXFlushAC97ViaCodecWaitGPIOdataV34DecodeDataram_m3MojacSMV22InterpolatorDispPCMLLSavegV22AnsSupressorCoeffsFaxFRM0SnooperDozeControlCmdV34P2ANSpcmSetXmtModeCallProgressGeneratorInitCdisRegProbeAgrLLEnableV34TrainingDiffDecoderAC97IntelCodecWaitGPIOV32ModulatorFIRV34ControlFindMaxRatesV34Phase2EnableL2SuppressorAgrPcmLLCptV92ClientModulatorTweakPhaseCAmrALiDisableCallerIDLoadMseSilabsRingDetectedV34TxDataSetPatternGeneratorPCMClientDemodulatorInitDashVCmdUsbMerCheckLoopCurrentCodecWatchdogHandler_SoftModemSetRefDataV22InterpolatorTimingOffsetTrackingEnableIMAADPCMEncoderSoftModemGetBuildDateSizeCAmrViaCheckErrorUsb_BoostArmClockV34RxDataSetMPDetectorgV34ModulatorFIRSpecTable8KHzSmpModemInitVLAddVLdp_int_regwriteUnflattenCommandgQC2UqtsTableCAmrSisShuntControlCAmrIntelCancelPMStateCAzlIntelEndTimerModeBuildOneDemapgstreaming_startedwDspCore_MClkTbx_usb_buffer_alloc_kernelLXRegistryInitV22ModulatorgV21AnsSupressorCoeffsazlGetResourceInformationVoiceLoopCurrentMonitorTimerInitLocalAnalogLoopbackgV34Trellis16TransitionTabledown_SMLite_FIRMWARE1MercuryChangeHwConfigV34P2L1L2CalChannelResponseDefaultProfileCmduss_write_bulk_callbackCAmrViaClearTxBufferx_task_queue_init_usbbulk_patch_v106V32DataPumpReportTrainingProgressPllGeneratePhaseAnglesFlushInBandResponseV22FrontEndResetLXModemPerformRXStopSpeakerphoneU2SetEnumerationLEDPCMClientEqualizerFreezeCenterTapV32DecoderInitx_pcibios_read_config_wordSuspendCallBackDetAMuMix6dBMnpFramerInitio_put_dte_tx_charAC97SLabsSpeakerV8ControlCIDetectedSPFHalfDuplexerSetDuplexSL3055ShuntControlV27ModulatorInitV32TrellisDecoderInitSetOddV8bisControlOrgRxWaitForToneOrCapStateV27ScramblerInitCAmrIntelIntExitV32DemodulatorResetCoefgCidChanRcvFIRCoeffsnumSupportedDeviceget_urb_contextV32PllGetPhaseErrorBlockLongAddUART_CommWriteCountV29DecoderInitV34NeecSetFastUpdateSetLoopDetCntCAmrSisCloseCAmrSisReadRxPositionBlackListingCheckNumberFskRcvDisableCarrierLostThresholdSmpModemWriteEchoCmdV22RxDataInputPtrATProcessorGetDebugRegisterV32ControlDefineEV8bisFlagsDetectedPPPolRingDetectedLapmGetFromQueueV27PllInitlin_pci_dev_get_irqCAzlIntelReadRxPositionV27ControlRcvInitio_dte_rx_eptrA3PolShuntControlV34P2ControlTxSend160msL1StateCDefaultCheckLoopCurrentLXSoftModemLineHandlerPCMViterbiInitLapmSendFRMRV34TrainingDecoderResetMercuryShuntControlDataModemXmtBreakModeCmdV8bisControlESrDetectedV17RxInitStateV8bisMainReportTrainingProgressLongCAcadiaOffHookMercuryDumpRegistersV34DemodulatorSetFullDuplexEqualizergPhaseSplitterCoeffsSL3055ShutdownCodecFramerSyncTxV8bisControlMReDetectedLuTranslateNoiseLevelCAmrIntelDisableCallerIDMerLiteSetHookgV34CarrierFreqTableV34P2L1L2PCMDetectorCDefaultRingDetectedCAzlIntelStartTimerModeATProcessorSpeakerControlUsbWriteGPIOUART_rts_offGetLLSrV92DataModeEncoderCAzlIntelShuntControlV16550_Write_MSRV32PllUpdateUpdateMseV34DataPumpInitV34P2ControlPrepareToStartNormalV34CDefaultEOIV34InterpolatorSetMediumTimingPhaseUpdateV29DemodulatorInitgV34MaxDataRateV29FrontEndInitgV92ClientXmtFiltergSendLessSamplesV29DecoderPCMClientDemodulatorSetDelayAdfScaleFreqTableV34NeecSetMediumUpdateget_dev_control_urbU2PolStatusHandlerIrqV251ProceedV32FrontEndAdjustRcvDelayCSV92PPTimeElapsedTxFaxHDLCHandlerCAzlIntelChangeHwConfigV8bisControlRcvVoiceRxDataHandlerV34RxDataSetJdDetectorsmdDspCore_SMMLiteVerbCallBackSmpModemAudioReadnegative_econnresetCAmrIntelSetPMStateV34ControlSetDataModeUpdateGainsV42bisTimerDisplayBlackListCmdV34P2ControlInitV8bisControlANSDetectedPCMClientNeecEnablex_linux_dbg_printV32SupressACQuietResultsCmdV22ControlSetRxRateV22ControlEnableFeedbackUpdateIdleTxAudioHandlerBlockShiftByteArrayV34Phase3RxInitStateFramerReportBreakV90TrainingDecoderSetTRN1DLocalGenerationResumeSpeakerphoneV34CorrelateV8ControlCommandHandlerPPPolShutdownCodecCAcadiaSpeakerATValidNumberCAmrViaSpeakerCDefaultReprogramDmaIntVLDivVLPerLiteShutdownCodecCSV92PPClearTxBufferLapmTimersV92ClientPhase3RxWaitSdBarStateV29EncoderBPFProcessCodecSpeakerphoneGrantedV32DiffEncoderSetRateJMDetectionTimerVLSHandlerx_current_timeV34MainPllSetFreqUpdatePaceLXRegistryGetFirstChildKeyV34DataModeEncoderVMODEM_Timer_ActiveUss_InitForUsingBulkEpsV34ControlSendMPV32InterpolatorTimingOffsetTrackingEnablewDspCore_PsVecV92DataModeEncoderSendRuV34P2L1L2RcvComputeChannelProbingOutputsgSoftModemVerionNumberStringdcloop_y10PCMClientInterpolatorResetScramblerX18X23SL3055DisableCallerIDV34P2L1L2ComputeL1SNRlin_obtain_regioncptDefget_dev_speedA3PolShutdownCodecFCLASSHandlerEFCSHandlergV34InterpolatorSymbolRateInterpolationRatio8KHzgetParameterPCMClientFrontEndEnableRapidPECTrainingGMRHandlerV8bisMainSetConfirmMSFunctionSPFHalfDuplexerEndV32PllFeecDemodulateAC97ALiCodecReadPPPolEnableCallerIDPciCodecInitLapmStartExceptionTimerV22EncoderSetRateGetDrnValueV90ClientCoderCalculateConstelMapwait_for_core_readCDefaultIntEnterContiguousToAligmentLapmSendDISCIMAADPCMInitBlockGenerateAnglesCAzlIntelReadTxPositionCAcadiaCancelPMStateset_dev_bulk_out_endpointAddrCAmrSisEndTimerModeCUsbConfigureCountryV34RcvV22bis16PointSlicerPCMSlicerInitV32DataPumpXmtMainPerseusSetRegisterPciCfgRawReadBellCmdgax_usb_put_devCUsbCheckErrorlin_timeval_get_secdp_write_dsp_regV90ClientPhase4TxSendSStateCAmrSisCancelPMStateV90TrainingDecoderV34DataPumpCommandHandlerSoftModemATPrintfSpeakerControlCmdExPulseV90ClientPhase4TxStartSCRStateCAzlIntelEnableCallerIDVDRHandlerlin_atomic_int_dec_then_is_zeroV32TrellisDecodeDataMerLiteSpeakergV34TrainingEmptyMapV34DataAssemblerFramerSyncInitV44DecoderInitCallProgressGeneratorLineDetectDumpSetMDistSetLLFailMerLiteRingDetectedV22ControlForceLoopbackTestV90DecoderSetDataModeMerLiteStatusHandlerAC97ViaAudioCodecReadIdleCommandHandlerV34P2L1L2ComputeGroupDelayLapmSetDisconnectedSmpModemCommandHandlerlin_pci_dev_fix_bus_masteringV22DemodulatorSetNominalEqCoefForGivenLevelSPFCorrelatorProcessV34ControlExceptionFAEHandlerVITHandlerAC97SLabsChangeHwConfigSetDataModeStartTimegp_modemsSmpModemTimerU2PolDisableCallerIDx_usb_buffer_free_extkMessageWaitingCallStringBasebandBETimingkOrigineMobileStringV29RxDataInitCAzlIntelCheckErrorcCoded14400MapPCMClientDemodulatorRestoreV92ParmsPCMClientInterpolatorCodecSendBreakConverterSetSampleRaterx_objectsx_usb_buffer_freeLXRegistryGetNextKeyFaxModemReportTrainingProgressLXSoftModemGetTXBufRoomReportChecksumFirmwareV27ScramblerCDefaultStatusHandlerCAmrALiEOISetWorkModeV92CoderUtilCreateCodingParamsU2PolShutdownCodecA2MuTblCAcadiaIntExitNoiseEstimationGetCptFlagFaxFRH1TimerSmpModemGetReadBufferSizeCodecModemCommandHandlerV34P2L1L2ComputeL2SNREmptyIOCallBackDelayLineManagerAdvanceReadPtrMercurySpeakerV8bisSendRawMessageCAmrSisStartgNeedToRestartDmaV34P2ANSpcmRcvAdjFrontEndGainoemATIStringBlockLongCoefFIRPNUpdateV8bisMainSetOutgoingMsgFuncSmpModemLineHandlerLapmStartTimerV29ControlRcvInitFaxModemRcvDescramblerX5X23main_init_mercuryV22RxDataStartSelfTestFramerAsyncInitACLinkResumeSilabsStatusHandlerCAmrIntelGetTimeAC97SLabsA2DebugCommandGetAgcGainV90ClientControlExceptionReportERMnpFramerGetTxFrameusb_req_clear_featurePerseusInitCodecV34TxDataInitV90ClientControlCreateCPDataV34InterpolatorSetMediumTimingOffsetUpdatePCMClientInterpolatorInitV34P2DPSKReadFromDataBufferBlackListingClearTablesx_release_regionLineSignalLevelCmdEWINDHandlerV34ControlSetFullDuplexIeecV22ControlRcvCAmrALiCloseAutomoderDisableAutomodingUART_ri_offkOrigineOrdinaireStringV22PassbandToBasebandSqrtLXHardwareCommonGetIRQgBelarusConfigRegistersSPFPowerThresholdProcessgV34JPrimePatterngIndexBitReversalTableCAmrSisStopV92ClientControlResetAutomoderControlFskRcvSetDataHandlerSoftModemGetMemoryPtrV22TxDataInitgLinRequestRegionFlag1UART_cd_onx_strcatgATHandlersV22ControlTxLoopback3InitStateU2PolPulseDialDigitV32DataPumpEnableSRCHandshakingkPayPhoneStringV22ModulatorSetRateAC97IntelCodecReadV8bisControlRequestMSV8bisRcvGetRawMsgDataLapmTxExceptionFrameSaveNewPatternio_at_esc_timerV34P2DPSKWriteToDataBufferCDefaultOnHookV27ControlClearDownPllGetPhaseErrorSmpModemAudioHandlerLapmSendXIDCAmrViaReadTxPositionV34FrontEndGetMagnitudeScaleFactorV92DataModeEncoderSendRmV32DataPumpRcvInterpolatorPQCHandlerSoftModemGetGMIStringV16550_Write_LCRV34PFeecSetSlowUpdateV34DecoderSetTrainingModelin_atomic_int_incDSROptionCmdLXSoftInitParamAgereLineDetV42bisEncoderResetICFHandlerAC97SisCodecReadlinux_modem_initLapmTimersClearV27Encoderx_sprintfV34P2ANSpcmXmtInitMercuryEnableCallerIDV90TrainingDecoderClearRBSErrorFlowControlCmd2LXRegistryCreateKeyMercuryDebugCommandFRHHandlerPCMClientInterpolatorSaveV92ParmsLXHardwareCreategetLastNumberDialedV34PFeecEnableAudioReadFlushV22ControlXmtCAmrIntelStartV34RxDataMPDetectorGetCompressionStringV29DemodulatorShiftEqDelayLineGuardToneCmdV34TxDataSetDataModeV34TxDataAC97SLabsA2CheckLoopCurrentV22TxDataSetRateudev_infoTE140HandlerAdfEncOutputV8bisMainReportStatusV32ControlDisableDemodulatorUpdateunsolCallBackAC97SLabsA2ChangeHwConfigV34P2ControlMHReceivedMHV90ClientPhase4RxWaitRiBarStateV34SwitchToPhase2V34RxDataSetCPdDetectorV32PllInitExtendedResultsCmdInternationalCallProgressInitV34P2DPSKXmtDataPutMHIntoBufferV92ClientPhase4RxWaitSUVStatex_strlenx_usb_fill_bulk_urb_txCAmrViaIntEnterV34ReportConnectionInfoLapmRcvFrameHandlerUsbDmaRxPositionV16550_Read_IERV34DataModeDecoderChangeDataRategSoftModemGMIStringSetLineDetFlagVTDHandlerVoiceTxTimerDTMFSilenceXmtInitcHandshakingV17MapV22DemodulatorUpdateCSV92PPEndTimerModeSaveNewDataSetV32DataPumpSetTxRatex_usb_submit_urb_kernelV22ControlClearDowntx_objectsDashLCmdMerLiteDumpRegistersudev_enumeratedwrite_vuart_portV34InterpolatorResetV27DescramblerFramerHDLCStartSAModecUncoded4800TableV34InterpolatorSetFastTimingPhaseUpdateV92ClientControlCreateCPDatareleaseHDAStreamV22DataPumpRcvResetMseV34ReportStatusA3PolSetRegisterAcadiaDMABlockByteCleario_app_tx_rptrgV34ShapingFilterTable8KHzV8bisControlAnsRxWaitForToneOrCapStateBPFStartV92UnFlattenVarsFaxFRH0TimerV22DataPumpReportTxRatewrite_eepromV22InterpolatorResetV8bisRcvEnableQTSDetectorgV29InterpolatorCoeffV32DiffDecoderInitAudioStatusHandlerUART_dtr_offVNHHandlerV22DemodulatorSetRateAC97ViaCodecReadCAcadiaRingDetectedgV34Trellis32TerminationTableIBMHandlerV22ControlRxInitiateLoop2TestStateLapmProcessDISCV29FrontEndBaudTimingAlignmentCAmrIntelCheckErrorCSV92PPOnHookV8bisControlDefaultConfirmMSLXSoftModemIsTXRoomAvailromDspCore_dpPatch0LoadOldDilCUsbGetTimePCMClientDemodulatorSetRcvOnlyModeV8bisControlResetLapmProcessUIStringCatSoftModemRevStringSizeDTASDetectorV92TrainingEncoderSetTRN2uEncodingV32FrontEndInterpolatorlin_atomic_int_initLXHardwareDestroyBlockShiftShortArrayMnpFramerGetRxFrameCAmrViaQueryPMStateV22ControlSetLocalDataRatesGetMseCntV32OrgRxInitStateV34DemodulatorSetDelayPCMClientFrontEndXmtTLDLHandlerV34TrainingDecoderSet4PointDataDecodingAudioRxV22DataPumpReportV24CircuitChangeUART_CommWriteStringConverterGetSampleRatePCMClientDemodulatorIeecInputPtrSilabsDebugCommandATCommandCallerIDHookStateV32PllResetFreqOffsetV34P2ControlMHSendMHreqCAmrSisGetTimedp_reset_dspCSV92PPEnableCallerIDUsbCodecReadV34ControlEventHandlerV34CoderUtilInitCodingParametersMnpQueueResendFramesV32FrontEndXmtGetMseV32EncoderEnableHighScaleFactorPCMClientFrontEndSetGainDelayLineManagerInitDelayLineV44TimerV29DemodulatorScaleDownCoeflt_add_timerClearConnectionStatusUDCmdV32FrontEndGetPowerFromGainCAmrViaGetTimeg2100HzCoeffsVoiceCommandTimerxkmallocgConvert7200To8000FIRio_app_tx_sptrSelectSRegCmdCheckNVRAMCRCMnpStatusSnooperreg_35mV34Phase2ResetXmtReadPointergV34SymbolsPerSecondTableV22ControlInitg1200HzCoeffsSilabsCodecWriteSilabsShuntControlCDefaultEnableCallerIDPCMClientCorrelatorInitVLAddLongIFCHandlerLapmMainMMCLV34P2DPSKXmtDataGetBitsV34P2DPSKRcvLoopDetV32SupressorInitLXHeapCleanupV92ClientControlCreateSUVDataCodecDrvWaitSmpModemGetWriteBufferSizeXCloseToYLXSoftModemPerformTXBreakV22PllUpdateManualV8bisSnooperV8ControlGenCMDataV34RxDataSetEdDetectorversionStrCAcadiaDisableCallerIDPCMClientFrontEndGetResidualEchoLeveladjustAccessedFlagV44EncoderProcessIdleEyeHandlerBlockShortClearLapmProcessSREJStartFaxConnectionTxFaxHandlerVRNHandlerScramblerX5X23V32HandshakeSRCResetV34SetPhase2ReceiveCSV92PPShuntControlCAcadiaChangeHwConfigPolarisDbgCmdVocoderTimerTestCmdV34DataModeDecoderAdjustRcvGainUsbMerEnableCallerIDV32NonlinearDecoderLXSoftModemGetTXBufUsedVLMultShortCAmrSisEnableCallerIDLXModemPerformTXClearInitiateOrgV251ConnectionFaxModemCalculateEyeQualityrxDilBlockLongFillUnalignedV32AnsTxInitStateagr_pci_find_deviceV8RcvEnableTONEqDetectorV34Trellis32SearchFaxModemXmtUART_dtr_onCodecUninstallIsrSilabsSetWakeupStateV34TrainingEncoderSetPPEncodingPerLiteInitCodecLXModemGetRXCharsAvailA3PolVerifyCodecIDbit15activex_stiFramerAsyncTimerV8bisMainSetModeSelectSilabsItnShuntControlFaxFRH1SnooperV90ParseCPV8bisControlSetXmtIdleBaseAddressIndexMercuryItnShuntControlgLongCompressionMessagesV34TxDataDisableScramblerV22InterpolatorTimingPhaseTrackingEnableFskDataPumpReportStatusV92ClientControlDisableUpdateio_uart_statusV90ClientControlXmtV44EncoderInitonceV16550_Read_MCRasync_clockchangeV34NeecEnableV27DecoderInitPCMClientDemodulatorGetNoiseCAzlIntelSpeakerCAmrIntelBufferHandlerV8bisMainXmtOutgoingMsgCAmrSisChangeHwConfigV32PllFeecGeneratePhaseAnglesHexToStringPCMInfidelityEstimatorVpcmDesFrmConsTblV32PhaseJitterRestoreSavedPredCoeffsFaxModemCommandHandlerModemConnectionInProgressV22PllResetlin_sys_error_to_errorLoadOldDistFrmEstUART_xoff_onBlockFIRESRHandlerPPWatchdogHandlerV34Phase2DPSKRcvSliceAndConvertMicrobitsJapanCWCallerIDInitGetReTrnCnt1CptCpProc3V92ConvertQC2ToQC1V90ClientControlSaveV92ParmsSetAthRetrncCoded16800TableDelayLineManagerInitReadPtrx_usb_buffer_alloc_atomicromDspCore_pHomodp_modem_commandV32DataModeRxStateV32FrontEndSetRcvDelayPCMClientDataPumpRcvV34P2ControlGenerateINFO0DatagV34J4PatternV29PllAdjustUpdateGainRxDataHandlerExV8bisControlDualToneDetectedV34ShellMapperV22ControlErrorPPPolShuntControlLuTranslateTerminationCodeV90ClientControlSendMPCAmrIntelCloseV34P2ControlAnsRxDetectPeriodicalB2224StateMnpSyncXmtFrameHandlerFramerSyncCommandHandlerMnpReportBreakV32ScramblerLocalInitPCMClientDemodulatorSetFullDuplexModeDecodeStringlin_use_lock_init_unusedATCommandProcessorSetStoredProfileV22RxCheckConvergenceStateV90TrainingDecoderSetFastConnectTRN1DLocalGenerationLXRegistryGetValueNamelin_atomic_int_getCAmrIntelOffHookV34ControlCreateMPFRMHandlerV29TxDataPciCfgWriteDwordCAmrViaEndTimerModeFPRHandlergV92ClientXmtInterpolationFilterDummyHandlerV8MainXmtV32PhaseJitterEstimatex_usb_start_dmaPPPolDumpRegistersAutomoderDetectorInitAC97ViaAudioCodecWriteV29DataPumpSkipRemainingRcvBlockJapanCallerIDInitLXHardwareCommonStartISRgV34Training16PointMapLXSoftModemPerformRXBlockPolyPhaseFIRagereSupDevicesgTrellisEncodeTableuss_writeStartLoopbackTestLapmProcessRNRV29ControlRcvgV23FwrdChanRcvFIRCoeffsPerLiteSetHookPerLiteStartV27DecodercUncoded9600TableV8XmtMnpFallbackCheckCUsbShuntControlCSV92PPEOIPP_board_enableGetDLIndexPCMClientNeecSetFastUpdateCAmrViaOffHookLXRegistryDestroyKeyCAmrIntelEndTimerModeV34ShortP2ControlSaveVarsV27FrontEndRcvMerLiteInitCodecgSubsetOffsetTableLXRegistryGetValueKeygIdleSupressorCoeffsV34P2DPSKRcvDataInitReturnCmdCAmrALiStopSoftModemSetMemoryPtrEnterManualV8bisStateV8bisMainGetModeSelectversionUART_data_bitsdp_sleep_modeCAmrIntelQueryPMStateVocoderTxV34P2ControlAnsRxINFO1StateV29FrontEndSetUpGainUsbMerShutdownCodecV32HandshakeSRCInitBlockShortMultiplyLapmReportStatusFlattenStatusAC97SLabsShuntControlV34DecoderInitCAmrSisIntExitPPCodecReadBlockComplexConjigateMultReasonCallIsStillInProgressV34Phase4RxWaitSStateV34ControlStartTxDataModeV34P2ControlSetXmtModeU2PolDebugCommandV34RxDataInitLapmCommandHandlerVLSubVLio_app_tx_countsv92download2dpramPerLiteSpeakerVoiceRxSnooperPPPolSetRegisterWaitForV8FinishSnooperFaxTransmitSilenceTimerLXSoftModemGetRXCharsAvailU2PolSetHookCUsbCloseV25GeneratorInitV8bisControlRxDetectMSStateDTMFSignalDetectorSL3055SpeakerV32DecoderResetTestInitLXModemCanStopV32DataPumpReportRxRatewDspCore_McVecx_bottom_halfV29DemodulatorUpdateV90ClientControlDetermineTxRateLLDumpOpenV34P2DPSKRcvInitx_kfree_devU2PolSetWakeupStateNewATCommandCallerIDTimerAC97SisCodecWaitGPIOMercuryCheckLoopCurrentHACnstMsegOsVersionPerseusVerifyCodecIDMnpResetCAmrSisQueryPMStateLoadStoredProfileV22CorrelatorPPPolCheckLoopCurrentV32DataPumpGetTimingOffsetCDefaultIntExitDataModemStatusHandlerV92ClientPhase4RxWaitRiStateReportInBandSAMRateAC97SisReadGPIOmemcpy2to4V27ControlXmtInitCAcadiaBufferHandlerSpeakerphoneRetrainCUsbBufferHandlerV90TrainingDecoderSetDILDecodingFTSHandlerV34DataModeDecoderInitlinux_modem_openEnterFRH0StateCallerIDRcvPulseDialDefaultCmdAddV34CntSL3026SetWakeupStateV16550_Write_THR_bufferAC97SLabsStatusHandlerLXSoftModemRegisterMCRChangeAC97SLabsDebugCommandDashCCmdV17AdjMainPllPhaseModemRegOut32V92ClientControlEventHandlerSpeakerphoneAudioRcvCAmrALiClearTxBufferSL3055CheckLoopCurrentV34TrainingDecoderSet16PointDataDecodingapp_pidCAzlIntelCancelPMStatekRingBackWhenFreeCallStringV8bisControlFrameErrorDetectedcCoded7200MapU2SetRingAC97SLabsA2SpeakerInitiateOrgConnectionusb_device_speedV34DecoderAC97SLabsA2ShutdownCodecGetArgumentSL3055InitCodecCAmrALiTimeElapsedAltRbsLrnTbliHPF4kBlockMapShort2ShortLapmProcessUAUtilQ4dBToQ12LinearV32FrontEndResetV34P2L1L2XmtInitV29DemodulatorV32TrellisDecoderSetRateV22DemodulatorResetLX_isr_handlerSmpModemInternalStatusHandlerwDspCore_SClkTbDebugModeCmdV32ControlSetLocalDataRatesUART_dce_break_onATCommandCallerIDPresentV29DemodulatorGetLargestEqualizerTapCallProgressSnooperV8bisRcvEnableFskReceiverV42bisEncoderInitLXHardwareInfoDestroyV34NeecSetSlowUpdateV22DataPumpInitBlockShortMoveUnalignedLineDetectx_usb_fill_bulk_urb_rxgV92RuBarPatternCDefaultStartIdleLogHandlerTransitionTimercUncoded9600MapDisplayConfigCmdCAzlIntelOnHookMerLiteShuntControlV92FlattenCallLogx_memcpyGetProtocolStringHeaderInitPerLiteShuntControlAnalyzeLoopStabilityV34PFeecCheckdown_SMLite_FIRMWARE2IsoUsb_StartIsoDmaModemOnHoldStartPCMUtilEncodeLXSoftModemCreateATProcessorV24PerLiteStatusHandlerAvrEstimateV8bisControlCRdDetectediabsdp_enable_ring_intEchoCancelStartV27InterpolatorTimingOffsetTrackingEnableCUsbSpeakerV34ControlSetFullDuplexFeecRxDataHandlerSpaceAvailableSPFDelayLocatorStartV32DecoderV34DemodulatorUpdateV29PllUpdategV34ModulatorCarrierSpecTable8KHzV29AdjMainPllPhaseSpeakerVolumeCmdToneDialDefaultCmdPerLiteConfigureCountryVMODEM_Get_System_TimeV34P2DPSKRcvSetCarrierOnThresholddp_mars_sleepFskUtilPhaseDiscriminatorManualV8bisTimerV34TxDataSetExternalHandlerV32InterpolatorResetTimingOffsetV34ControlClearDownV22DemodulatorNoisePowerCalibrationEnablelin_error_descCodecWriteTextStatusSmpModemAudioTxDataHandlerLapmStatusSnooperVoiceSetCallProgressParametersV34P2DPSKRcvFindPhaseReversalLocationSuspendSpeakerphoneV92EncoderSetDataModeUsb_HandleStartDevicegUsbQueueV32TrellisEncoderV34P2L1L2ComputeOffsetsV34PllGetPhaseErrorBlockIIRx_usb_reset_pipedp_regandorV44EncoderGetCompressedDatatempmapMercuryCodecReadSPFRampingAttenuatorResetIBCHandlerV92ClientControlGuessServerModemTypeMnpCommandHandlergLeftOverSamplesCUsbOnHookbit15lowCallWaitingEnableDetectorV34TrainingEncoderSet16PointsEncodingV34SetSampleRateFaxModemReportStatusV16550_Read_LSRV34TxDataAuxV32RxDataResetV34DataPumpRcvMercuryCodecWriteromDspCore_PsVec0ReportDRVocoderStatusHandlerCSV92PPIntEnterSoftModemGetRcvPowerV32ScramblerLocalPMHHandlerVoiceStartCallProgressSPFDelayLocatorEndTransitionSnoopertmpV90ClientCoderCheckRcvCodeMapEligibilitygPCMClientInterpolatorFIRWRITE_UART_REGLXSoftModemSetRingStateset_transfer_in_progressSetPulseDialDigitIMAADPCMNextStepIndexcUncodedV17MapSpeakerphoneAGCResetget_devPCMClientDemodulatorSaveV92ParmsFbkReTrn5821UART_SetQuegV34Modulator3200To8000CoeffsAutomoderSupressorV22bisIdleScramblerCAcadiaStopdp_regwriteAC97ViaReadGPIOio_dte_tx_eptrnegative_enomemPerseusRingDetectedV34ControlCreateSeamlessRateChangeFrameGetMseAvrSaveSignPatternBlockShortInvertV29PllDemodulateV27InterpolatorTrackTimingMnpEstSMWhiteNoiseXmtPPPolConfigureCountryCallProgressSignalDetectorGetFileFlagV29InterpolatorTrackTimingATParserNotUseSL3055SetHookAC97IntelReadGPIOSL3055ChangeHwConfigV34EncoderSetDataModeV22PllFastTrackingEnableReadPatternDataAltRbsInitCAzlIntelStartUsb_StopIsoDmaBlockShortOffsetV34TxDataSetPendingPatternAlignedSendBasicInBandCommandSetAltRBSCDefaultOffHookU2PolEnableCallerIDESHandlerV34RxDataAuxUART_stop_breakBaseAddress2BuffersReadFrameJapanCIDMessagePartitionESAHandlerwriteBlock2dpramCUsbCheckLoopCurrentmars3onMnpMainV44ReportErrorV34DemodulatorGetSNRV32HandshakeSRCXmtBlockLongMoveUnalignedCodecNum2Str10V27DataPumpRcvV34RxDataResetAudioWriteIdleTxStartDataConnectionGCIHandlerUART_FlushGMIHandlerV29DecoderSetRateSPFPowerThresholdResetdp_write_dsp_ramV22ControlCheckForcedActionsMnpBreakXmtVoiceInitCallProgressAfterDialU2PolConfigureCountryV34TrainingEncoderSet4PointsEncodingLapmSendTESTPerLiteSetRegisterV92ClientControlClearDownBuffersWriteV34ShapingFilterSoftModemGetFullManufacturerNameLXModemPtrToMinorDevNumLapmResetVarsgLinReadFlag2gV32AnsSupressorCoeffsPCMClientFrontEndInitget_endpoint_addressV8bisXmtCAcadiaOnHookV34P2L1L2PCMCalculateBandEdgeFilterNumberLinkLayerStatusHandlerCAmrIntelRingDetectedV34InterpolatorSetSlowTimingPhaseUpdateLXModemInitIsDirInDSHandlerV253ReportCallerIDCDefaultReadTxPositionCAzlIntelStatusHandlerIsCmdCompletedBlockShortMoveMerLiteDebugCommandV34P2ANSpcmRcvApplyWorkaroundsDashSCmdVRXHandlerMnpSendBreakV34DemodulatorInitDialerCommandHandlerV8bisControlOrgTxSendSilenceBeforeMReOrCReStateSetMaxTxRateATProcessorWriteSpaceAvailableMnpFallbackDisableMercuryShutdownCodecGetSRegCUsbCancelPMStateCSV92PPStopLoadPowCmpstSoftModemDisableDCOffsetTrackingV34ModulatorSRCReleaseCodecMaskAC97SLabsA2ConfigureCountryV32ControlClearDownV32DemodulatorAdjustEqualizerGainUART_dce_break_offBlockCorrelateAutomoderSupressorInitLapmT402ExpiredCallProgressMonitorInitModemOnHoldEndromDspCore_PsVecIdleXmtV22ControlSetTxRateV34FrontEnd60HzFilterAC97SLabsDisableCallerIDV32DataPumpReportErrorUsbDmaTxPositionpci_base_address_1PIGHandlerMOHRealPartOfComplexConjugateMultiplyUtilSqrtshortBuffersV8ControlGenJMDatareg_34vCAmrALiInitio_dte_tx_sptrCAmrIntelSpeakerPassbandBETimingLapmRxDataHandlerPerseusDebugCommandV32PhaseJitterSetUpdateGainkcountLXRegistryCreateValueAC97AzlIntelCodecWaitGPIOx_linux_dbg_print_critm3_mer_initCAcadiaTimeElapsedV32RxDataPCMModemSetPadTypeV32PhaseJitterUpdateATCommandOfflineHandlerJMDetectionSnooperFramerAsyncTxkmalloc_dev_bulk_in_buffergConvert8000To9600FIRU2PolChangeHwConfigV29DemodulatorSetRateATProcessorInitVarssMuLinLXRegistryGetValueDataV27RxDataInitV22ControlTxR1At1200StatePerseusChangeHwConfigMAHandlerSetVLSLXHardwareCommonStopISRBuffersRxDataHandlerV34TimingOffsetRecoveryInitV34SuperframeSyncV22ControlRxLoopback3InitStateCalculateRelativeGainQ12CallerIDReportMessageLapmProcessRRSPFRampingAttenuatorStartgConvert9600To8000FIRaI2LinTableA8EHandlerLapmProcessSABMEgPCM2PCMNoPadModemRegOut8BlockDotProduct2GMMHandlerV34PllCommitUpdateSilabsDownloadLXRegistryGetValueByNameLXHeapInitVoiceInitCallProgressgV23AnsSupressorCoeffsASTOHandleragr_outpMnpComprInitCSV92PPCancelPMStateStopLoopbackTestio_dte_tx_rptrV32DataPumpSetRxRateTALHandlerV8MainInitFTMHandlerV34P2L1L2PCMDetectedRBSGetLLSaveFlagV34P2ANSpcmRcvFMIHandlerV27ControlRcvV22PllPhaseUpdateEnableSetPMELevelUsb_CopyPlayBufV34ModulatorVEMHandlerSetProEndFaxModemInitPerLiteSetWakeupStategV23BkwdChanRcvFIRCoeffsV34P2L1L2RcvSetModeDCDOptionCmdwDspCore_pInitSetConverterV34P2ControlClearDownRingFrequencyDetectInitMnpSMCallWaitingSetSampleRateCAcadiaShuntControlm3_Silabs_initExtractInBandCommandsV27DemodulatorUpdategDefaultDebugHardProfileEFRAMHandlerLapmTxSREJFrameSmpModemWriteFrameDataCompressionCmdBlockComplexSumV8bisControlSetRcvIdleLapmSetOwnClearV90TrainingDecoderGetPadScaleGetPowerStateV34EncoderV34P2DPSKRcvDataPutBitsV34ShapingFilterInitSmpModemCountWritePendingCAmrViaSetPMStateCdisRegReadPCMClientDemodulatorResetV34ShellDeMapperInitLapmReportDisconnectBlockLongMoveModemResetg1300HzCoeffsAutomoderSupressorSetModulationSoftModemGetShortRevStringSetPowerStateCUsbStartV90ClientPhase3TxInitStateGetLLStepUss_DownloadAndSetWorkAroundgV34TrellisSubsetToSymbolATPrintfV16550_Write_LSRV34InterpolatorDisableTimingOffsetUpdateLimitMaxRateCSV92PPCloseInactivityTimerCmdSetHARetrnWndpci_base_address_io_maskV27InterpolatorV34MPDetectedcCoded9600MapCUsbReadTxPositionwDspCore_mcCoreV34P2ControlAnsTxWaitRemoteMDGoneStatekmalloc_devAC97ALiCodecWaitGPIOSMInternalIdleTxDataHandlerV34P2ControlAnsRxWaitForRetrainStateregistersV16550_Read_RBR_buffergV34CarrierIndexTablelin_pci_dev_get_mmap_1lin_atomic_int_decCallProgressCommandHandlerV8bisControlFrameDataRcvedCAmrViaEnableCallerIDMerLiteCheckLoopCurrentEchoCancelResetFindMatchCdisGetAbsSystemTimeLuGetS133gV92RuPatternV92TrainingEncoderResetget_dev_bulk_out_endpointAddrvxdPortCloseV34DataModeRxStateBuffersReadFlushCSV92PPBufferHandlerGetBkThrDetectAltRBSPMHRHandlerget_urb_statussprintfLXHardwareStartBlockShortSubtractCDefaultDisableCallerIDwDspCore_sdCoreV32EncoderSetRateV34ControlXmtV34DataParserFaxFRM1Timerglt_create_nvram_flagget_transfer_in_progressV8bisControlTimeoutV34Trellis32WalkBackPCMClientDemodulatoruss_deleteIdleBlockPowerInBandCommandParserV34TimingOffsetRecoveryV34P2ControlRcvcEmptyMapV90TrainingDecoderSetTRN1DDataSlicingV92TrainingEncoderSetTRN1uEncodingPCMClientDemodulatorSetLongIeecReportMRGetQuickDilFlagPMHTHandlerUtilLongLongAtan2MnpAckRcvIdleTxDataHandlerV32CorrelateBlockByte2SymbolgToggleDataLedV92ClientControlXmtVoiceDialingTimerV8bisRcvEnableToneDetectorCUsbIntEnterget_endpoint_attribAzlDmaAllocationUsbMerChangeHwConfigMatchStringClearBlackListCmdLapmProcessDMMnpInfoInitResetInBandResponseV27DemodulatorUART_backgroundBlockSumSmpModemLineHandlerXmtA8THandlerFskXmtSetDataHandlerV32RxDataInitV32DemodulatorGetNoiseCDefaultReadRxPositionV8bisRcvGetMsgDataATProcessorUpdateNVRAMCAcadiaStartTimerModePMHFHandlerV22DemodulatorFramerCommandHandlerAC97SLabsRingDetectedLinkLayerReportBreakGetConverterStreamV22RxDataSetRateV32InterpolatorBigTweakV34TrainingDiffDecoderInitlin_release_regionSL3026ShutdownCodecFunctionResetV34PFeecSetFastUpdateCodecMainGlobalInitDialCmdgUsbQueueDataPCMClientDemodulatorSetLongEqualizerV32RxDetectNearEndPeriodicalStateV27DataPumpSetTxModeV34FrontEndSetShortPFeecLapmReportParameterLXSoftModemStartCodecSpeakerphoneWriteAudioCSV92PPInitV8bisControlReceivedMSFromRemoteV27ControlCleardownRequiredCAmrSisBufferHandlerSilabsEnableCallerIDx_kref_initold_app_cbqTxPCMClientFrontEndSaveV92ParmsV34P2DPSKXmtDataPutINFO0IntoBufferSmpModemATPrintfLXHardwareCleanupAnswerCmdV32DemodulatorgV34Trellis16SubsetToSymbolV34DemodulatorSetEchoOnlyModeSetLUCountryCodeS133HDLCCommandHandlerg1650HzCoeffsSetSRegCmdGetSpeakerphoneStateCAmrALiStartTimerModeV34P2ControlGetRcvINFO1LengthV32FrontEndNeecFreezeV42bisReportErrorAudioInitCAmrIntelClearTxBufferV34TimingOffsetRecoveryEnableV27DemodulatorInitV34P2ControlOrgRxDetectAfterL2PeriodicalStateCAmrIntelReadRxPositionV8ControlRcvlin_use_lock_useDialerInitV32DescramblerInitPerLiteVerifyCodecIDFaxReceiveSilenceTimerPciCoreDownloadBuffersWriteFlushV34FrontEndGetRxLevelV34ModulatorSRCFIRU2ValueBlockCplxFIRSilabsShutdownCodecSmpModemTxDataHandlerx_strncpyIsBulkXferV34P2ControlAnsTxSend1st50msPeriodicalStategV34P2DPSKFilterCoefCDefaultStopPCMClientDemodulatorPredictorResetParityApplydp_read_dsp_ramU2PolVerifyCodecIDExtendedSyntaxCmdATCommandCallerIDRingOnCAmrViaStartTimerModeLnxTransferCodecVerbsWritePciCfgReadByteV90TrainingDecoderCalculateDistinctFramesio_write_dte_fifoSpeakerphoneSetVolumeset_urb_no_transfer_dma_mapMnpAdfDecV34Phase4TxSendSStateIdleRxAudioHandlerMohRestoreAfterDialDTMFSpeakerphoneAGCEndV22FrontEndInterpolatorV90TrainingDecoderGetPadTypewDspCore_mpCorevxdDosChangeQueuelin_isr_obtainInitiateAnsV251ConnectionV8bisControlTxFinishSignalAndIdleStategSoftModemShortVerionStringx_usb_get_devV8bisControlMoreCapToXmtV22ControlRxWaitForRetrainS1StateV44RxDataCallerIDInitSelectModulationCmdLXSoftModemCanStopNotUseSL3026SetHookV32PhaseJitterResetDelayLineLLDumpCodecSetCodecIdStringV34Phase2XmtV27FrontEndInterpolatorV22DataPumpXmtSpeakerphoneReportStatusV29InterpolatorInitVGMHandler__interruptCountsmdDspCore_PsVecFIRFindLongCoeffSubsetLoadAltRbsV22CorrelatorInitCAmrALiStatusHandlersetResumeCallBackFlowControlCmdV27ModulatorValidDialModifierV29DataPumpInitset_dev_write_urbTRDLHandlerV92ClientControlExceptionUtilQ0LinearToQ4dBgV34SPatternV22DecoderInitSilabsConfigureCountryDelayLineManagerWriteCSV92PPOffHookBlackListingCallFailedV34PhaseJitterCancellerUpdateCAmrViaConfigureCountryV32TrellisEncoderInitPerseusDumpRegistersTERDLHandlerLLGainInitV8bisXmtSetModeCodecGetCallProgressAudiogLinReadFlagAgereDataModeAnalysisV34EncoderResetMnpReportErrorGetAndSignalEventSpeakerphoneAGCProcessV42bisDecoderResetVGTHandlerCAcadiaGetTimePCMDecoderIdleV27ModulatorInputPtrV8bisControlAnsRxWaitForCReStateLLFailset_dev_control_urbDRHandlerUsbMerStatusHandlerV22FrontEndSetAgcV32DemodulatorSetRateReadArgumentsComplexFFTwrap_uss_read_bulk_callbackATProcessorReadFlushBuffersReadPerLiteSetBizarroPerLiteRingDetectedUtilBlockCosSinPCMDecoderGetRcvMapMinDistanceV34PllFeecDemodulategV34Training4PointMapkOriginePubliphoneStringATCommandOfflineSnooperCAmrALiRingDetectedx_save_flagsV90TrainingDecoderSetRiDataDecodingGetArgumentRadixAC97SLabsSetHookCAmrViaStatusHandlerBlackListingCallIgnoredBlockFIRUpdateMerLiteSetRegistergUsbCodecStatusFlagV29FastBSQPCMClientDataPumpInitV32CorrelatorBuffersTxDataHandlerV22DemodulatorRcvSymbolPtrGetSRegFromProfileV34ControlRcvV32TxDataSetShortPatternBlockMapShort2ComplexSmpModemAudioRxDataHandlerV8bisControlRxFinishCLThenSendMSStateCSNEXTlin_use_lock_unuseReSetLineDetFlaggUkraineConfigRegistersV92EncoderV34PllGeneratePhaseAnglesram_m3PersDmaSMV90ClientControlGuessServerModemTypecUncoded4800MapV34TrainingDecoderInitPCMClientFrontEndEnableHiPassCorrectorCDefaultShuntControlPulseDialOptionsCmdx_usb_commandV27ControlXmtRxFaxHandlerV8bisRcvGetRevisionNumberIdleEncoderHandlerwDspCore_mcInitV34MapperV34Trellis64SearchV29GainPhaseEstimateVectorCptCpProc4MSHandlerV34EncoderInitUsbMerSpeakerV32ControlRefineRgDistinctiveRingsV8bisControlRxDetectCLMSStateCallWaitingDetectorInitU2PolInitCodecV22FrontEndBaudTimingAlignmentV34DemodulatorSetFullDuplexIeecV92ClientControlErrorCAmrIntelInitgShortConnectMessagesResetCmdV22PllFreqUpdateEnableREAD_UART_REGx_MOD_INC_USE_COUNTPciFindDeviceSL3026VerifyCodecIDV34FeecPllSetFreqUpdatePaceBlackListingTimerCalculateMeanPowerReportOctetStringCAcadiaClearTxBufferBackRetrnCntV8ControlGenV92QCDataBlockByteFillV34ParseSBitsLoopFaxWaitBeforeIdleSnooperSL3026ShuntControlV22ControlRxOrgInitStateAcadiaWatchdogHandlerSL3026StatusHandlerRadix8io_app_tx_eptrSL3055SetHookExtractPhoneNumberBuffersCountReadPendingV34P2DPSKRcvDataSetModeBlockShortInterpolateV29RxDataInputPtrV8bisGenerateMSBlockSymbol2ByteCAmrIntelStatusHandlerAC97SLabsSetWakeupStateV34ShortP2ControlOrgSend50msPeriodicalStateCSV92PPGetTimeGetAzCodecIDPPPolInitCodecgV34Trellis64TransitionTableV22ControlRxLoopback3TrainAt1200BpsStatePCMClientDataPumpXmtV34DemodulatorV34P2L1L2AdjustSNRDueToGroupDelayPCMClientDemodulatorSetDataModeV34P2L1L2CalEqCenterTapOffsetagr_inpwU2PolCheckLoopCurrentV90ClientControlInitx_atomic_dec_and_testg2400HzCoeffsV34FrontEndInterpolatorUsbMerDisableCallerIDPCMClientDemodulatorSetIdleModeBlockExtractRealPartCUsbTimeElapsedV34P2ANSpcmRcvRecognizedConnectionUtilLongShortAtan2MerLiteEnableCallerIDIPRHandlerPCMClientFrontEndRcvMerLiteCodecReadV32DiffEncoderV92ClientControlCheckClearDownV8bisControlCommandHandlerV34DemodulatorScaleDownCoefV32CorrelatorSRCV16550_Write_IERLXSoftModemPerformRXClearGCIDisplayDisabledcurrentCountryDialDTMFAfterHookFlasheepromATCommandProcessorInitV34IEECInterpolationDisablekOrigineMobileTransGroupeStringVoiceSignalStatusSnooperV34InterpolatorFIRInitMnpEstStartSetHAFlagUsbMerSetWakeupStateV44DecoderProcessSL3026SetHookV29ControlXmtBytesNeededV29EstimateCoarseGainAdjSpeakerphoneLineXmtVocoderCommandHandlerx_usb_fill_control_urb_rxV34P2ControlAnsTxSend2nd50msPeriodicalStateModemDisconnectV8ControlGenCIDataA3PolarisRegReadPowDevUsb_HiSpeedStringGetScaleV34PllDemodulatex__SLOW_DOWN_IOLoadLUCountryDefaultsV27FrontEndEnableAgcV34Phase2RcvGetRateValuegV34InterpolatorCoeffPtr8KHzgIsDeviceHighSpeedIDSRHandlerV44TxDatalin_isr_initV32ControlXmtgV34EPatternold_app_pqTxx_atomic_inccCoded12000TableV34P2L1L2RcvInitCodecMainGlobalExitNormalCnstMseCAzlIntelRingDetectedUpLevel2sALinBV34DemodulatorSetFullDuplexModeCodecReportStatusV8bisRcvDataHandlerPPPolPulseDialDigitA3PolDebugCommandV32ControlInitx_free_irqV90TrainingDecoderGetDistinctFrameIndexSetUnsolicitedResponseV90TrainingDecoderAdjustRcvdMapsx_request_irqV34P2ControlExceptionHandlerCAcadiaEnableCallerIDMercurySetRegisterRxDataHandlerReportA8TStatusio_app_tx_data_updateDescramblerX18X23ATCommandCallerIDOnCallWaitingSnooperPerseusDisableCallerIDV90TrainingDecoderCalculateRcvdMapsATCommandStartCallerIDOnCASToneLapmXIDConfigureGetV44CompressionMaskV16550_Write_THRV22PllDemodulategV22OrgSupressorCoeffsV34P2ControlAlignRxBlocksBlockDotProductAC97SLabsA2RingDetectedA8MHandlerGetMDistSilabsVerifyCodecIDBlockCRCV92ClientControlSetDataModeUpdateGainsV34P2ControlTxPeriodicalAndNonTerminating10msStategV34P2DPSKCarrierTableV22ModulatorFIRio_get_dte_rx_bytesV27DescramblerInitdcloop_countBlockReal2ComplexMaccUtilBlockCosTSELFHandlergPCM2PCM3dBPadLinkLayerCommandHandlerSetConnectionSAMIsActiveCAcadiaReadTxPositionLapmSetConnectedusb_recip_endpointGetFastRetrainFlagPCMClientNeecSetSlowUpdatev253RestoreFactorySettingsV34TimingOffsetRecoveryCalculateUpdateGainRxDataHandlerShieldEMV34P2L1L2PCMDetectedDigitalConnectionV22ControlTxOriginateWithS1StatePerseusStartbhQueueOffsetwrite_offsetcCoded19200TableV34DataPumpXmtCUsbChangeHwConfigCAmrViaInitPulseSampleValueUART_SetTxQueMnpSendLNAV34ModulatorDisableV22PllStartInitFreqOffsetCalculationV8bisMainGetRemoteCapabilityLXRegistryGetChildKeyByNameSpeakerphoneAGCStartCSV92PPChangeHwConfigCUsbRingDetectedCAmrViaShuntControlConverterGetXmtFIRCoefRealPartOfComplexConjugateMultiplyV32ScramblerRemoteInitLXRegistrySetKeyNameSpeakerphoneInitBlockIIR2SoftModemEnableDCOffsetTrackinggPCMMulaw2LinearNoPadx_sleep_modegV34TimingOffsetRecoveryPPM2SampsTable8KHzV90SpectralDeShapergV34TimingOffsetRecoverySamps2ppmTable8KHzCUsbOffHookV34ControlResetV90ClientControlDisableUpdateV34P2L1L2PCMDetectorInitV90TrainingDecoderAverageAcrossSymbolsgV34TrainingPPMapANSpcmUcodeTableSmpModemWriteSpaceAvailableStoreProfileCmdOperatingModeCmdAltRbsSlicerTblV8bisMainXmtgGlobalPtrCAmrIntelReadTxPositionA3PolSetWakeupStateV16550_Write_FCRATCommandCallerIDSnooperV32FrontEndSetFeecDelayV22PllResetPhasex_do_gettimeofdayMseFilterwrap_uss_disconnectV90ClientControlClearDownMnpReportFallbackAC97ALiWriteGPIOV90ClientControlEventHandlerV34TimingOffsetRecoveryActivex_kfreeSleepModeTimerdown_DPRAM_ASROMSmpModemGetRefDataMnpDequeueVoiceModemXmtgV34J16PatternGetReTrainV34DecoderSetDataModeV8bisControlOrgTxESiThenDesiredSignalStateATResponseLXModemGetTXBufUsedV34DemodulatorGetIELevelUsbMerVerifyCodecIDV34P2ControlSetRcvModeV92EncoderResetio_dte_rx_wptrVDTHandlerSoftModemCommandHandlerBlockShortFillAC97ALiReadGPIOV92ClientModulatorResetVTSHandlerKeyHitLongSpaceDisconnectCmdAC97SLabsSetWakeupStateNoGPIOV17StartGainPhaseEstimationPCMClientDemodulatorCommitUpdatecUncoded2400MapV32DataPumpInitV34RateCompensationXmtGainV27DataPumpXmtV34P2ControlRxPrepareToProcessL1StateUtilCosSinV29TxDataSetRategBestLinkTableCAcadiaQueryPMStateCodecSetSregV34FrontEndSetGainPCMClientFrontEndInterpolatorV22RxDataSetExternalHandlerA3PolSpeakerreg_35vCSV92PPDisableCallerIDSilabsCodecReadAC97SLabsA2InitCodecBlockComplexMultVerbTransferx_kref_putLapmXmtFrameHandlerCodecInstallIsrV8BisRcvHDLCDataHandlerFramerTxBlockByteMovegV34TimingOffsetRecoveryHighBandCarrierSpecTable8KHzFramerHDLCInitAdfDecSortFreqTableapp_ioctl_handlerio_at_esc_stategetCapabilitiesV32DemodulatorRestoreSavedEqlCoeffsCAmrSisSpeakerLapmDeliverDataCodecSetHwIdStringSL3055ConfigureCountryLXHardwareInitPCMModuloDecoderV92ClientControlInitx_pcibios_presentV34ControlEnterDozeModeCAmrSisClearTxBufferJackControlCmdV34CommandHandlerV29InterpolatorBigTweakCAzlIntelCheckLoopCurrentCAmrALiEnableCallerIDtPostDialV34ECInterpolationDisablex_usb_copyplaybufCSV92PPRingDetectedV42bisDecoderFlushDTROptionCmdCAzlIntelQueryPMStateCControlCmdV34CorrelatorInitModemRegIn32x_debug_msgV34ShellMapperTablecCoded14400TableV34P2L1L2XmtV27DecoderSetModeDataModemInstallModulationdcloop_zdiffV22ControlTxAnsInitStateMnpInitFilterInBandCommandsMNPBlockSizeCmdFbkReTrn5820gUsbQueueCountLineSignalQualityCmdV22ControlRxWaitS1EndStateATProcessorWriteFlushUtilShortLongAtan2LXRegistryGetKeyNameSendBreakCmdmLite_codec_initV32DataPumpDisableSRCHandshakingLXSoftModemPerformTXClearGetSRegCmdgV21RcvFIRCoeffsLXRegistryDestroyValuex_usb_set_interfaceV34InterpolatorFaxModemReportConnectionInfoV29FrontEndReportHitMercuryStartCAmrALiSpeakerV29RxDataVoiceTxDataHandlerpci_interrupt_lineCAzlIntelBufferHandlerV90TrainingDecoderGetRcvdMapsA3PolInitCodecMerLiteDisableCallerIDLoadMaxPowHDARunDmaV32FrontEndNeecActivateV32FrontEndSetAgcGainPCMInfidelityEstimatorInitFskRcvGetProEndeeprom_flagPerseusSpeakerV8bisControlESiDetectedPCMViterbiDecoderA3PolConfigureCountrylin_get_pci_cfg_irqCallingToneGeneratorInitIdleNonLinearEncoderHandlerAudioTxSilabsSetRegisterPrintOKResponseRetrnMseAdjCAmrIntelConfigureCountrygDisconnectReasonTableUsb_CommandTDLSHandlerV29DataPumpSetDemodulatorProcessBlockSizeV34Trellis16SearchmicGainLoadRbsMapShortV29RxDataSetRateV22bisIdleDataToConstellationCUsbIntExitset_dev_ifCAzlIntelClearTxBufferCalculatePowerRatioQ8PackBMSV32DemodulatorInitUsbReadGPIOSoftModemAuxTxDataHandlerV29GainPhaseInitCAmrALiReadTxPositionPCMClientCorrelatorFskDataPumpInitLaunchTapiMsgAppletAC97ViaCodecWriteAutomoderInitagr_outplA3PolDumpRegistersV32DemodulatorGetLargestEqualizerTapgV34bisMaxDataRatenegative_enonetV90TrainingDecoderSetShortDILDecodingTRDLSHandlerV34PllFeecGeneratePhaseAnglesV29EncoderSetRateCAcadiaReadRxPositionPCMClientFrontEndSetShortNeecx_pcibios_write_config_wordV90TrainingDecoderSetShortDILBlockReal2ComplexMultV32DataPumpCommandHandlerV34Phase2ResetRcvDelayLineU2PolRingDetectedV29DemodulatorInputPtrSL3055StatusHandlerg390HzCoeffsFskXmtInitdum_dp_dsp_isrx_check_regionV34DemodulatorSetDataModeCAmrIntelIntEnterMercuryVerifyCodecIDV34TimingOffsetRecoveryDisableV90ClientControlRefineServerModemTypeV32ControlEnableDemodulatorUpdateV34InterpolatorSetVerySlowTimingOffsetUpdateV34FrontEndSetLongPFeecGetNewLineFlagATTimerV34DataModeEncoderChangeDataRatex_queue_taskV34TrainingDiffEncoderInitV32EncoderMerLiteSetWakeupStateFMMHandlerCAmrALiGetTimeCAmrIntelCheckLoopCurrentV34ExceptiongLineBPFQ14LapmSetDLCIV34DataModeDecoderBuffersWriteSpaceAvailableV92ClientControlInitVarsGetDrnV92ModuloEncoderInitV34ControlDetermineRatesCAmrSisStartTimerModex_usb_set_intfdataV34PllRemodulateV22PllStopInitFreqOffsetCalculationV34FrontEndSetShortNeecPCMClientDemodulatorGetSNRGetCleanDataFlagAudioSetTxDataHandlerPerLiteDumpRegistersUART_rts_onV34P2ControlOrgTxINFO1StateCAmrIntelStartTimerModeCSV92PPIntExitAsyncModeCmdLapmDiscardRxDataV32SupressAAx_vfreeV8bisMainFskInitV22FrontEndQuerySignalPowerV22ModulatorInputPtrFramerHDLCRxV32InterpolatorV34DecoderResetgV22InterpolatorCoeffpci_base_address_2V90ClientControlStartTxDataModelapmDisconnectStatusResultsFormCmdgV34Trellis64TerminationTableFramerTimerLinkLayerTimerVNHEnabledV22RxDataCalculateSelfTestBitErrorRateTxDataHandlerV29PllInitV92ClientModulatorCAzlIntelStopA3PolEnableCallerIDPCMDeMapperV34P2DPSKXmtInitV22bisPhaseChangeSlicerkOrigineTestStringSmpModemReadV42bisDecoderInitLineTypeCmdAutomoderDetectorLXModemIsTXRoomAvailPPCodecWriteV34EncodeDataV34ControlDisableUpdateDelayLineManagerClearDelayLineV29EstimateFineGainAdjV34DemodulatorGetSERgNumMaxIrpslin_pci_dev_get_subsystem_idx_atomic_setATCommandCallerIDPolarityReversalDetectedV29ModulatorV22FrontEndInitGetMaxTxRateromDspCore_McVec0A3VersionGetmLevDialingSnooperx_kmallocV32PllTweakPhaseProcessCharacterTimeGapget_num_endpointsConfigAgrConstBPFEndVTXHandlerLXModemMinorDevNumToPtrSmpModemCountReadPendingCallProgressMultiToneDetectorSPFPowerThresholdEndCAmrALiOnHookGetHDABaseAddressDataModemRcvUnflattenStatusFramerInitSoftModemInternalRcvInterpolatorSPFRampingAttenuatorProcessV16550_Read_LCRV34DemodulatorGetFELevelx_iounmapCAmrALiQueryPMStateVocoderRxV22DataPumpCommandHandlerV90TrainingDecoderSetFastConnectTRN1DDataDecodingV34ControlStartRxDataModePerLiteEnableCallerIDGetMdistio_app_tx_wptrV90ClientCoderCalcNumOfConstellationsV8bisDisableOutgoingMsgVoiceCommandHandlerV22ControlForceRetrainAudioCountWritePendingPCMClientFrontEndGetNeecLevelV22TxDatalinprintDS44HandlerDataModemReportModemSignalCallWaitingCmdSetSRegSaveMseAvrsMuLinBgRecDmaBufferGetVerboseDisconnectReasonLLGetParaGetServerRetrnCntV32TrellisPostrotatePerseusSetHooklin_pci_dev_get_first_matchV34InterpolatorTweakTimingAlignmentLapmRestartTimersV34InterpolatorGetTimingOffsetPciPME_enable_NTV34PllFeecGetPhaseErrorUART_dtr_blockedVRAHandlerCAmrViaReadRxPositionAutoModeCmdATProcessorStatusHandlerV22RxDataMnpSyncInitV32NonlinearEncoderModemRegIn16LapmProcessFRMRdp_out_portCDefaultBufferHandlerDPRam_DownLoadCAcadiaStatusHandlerIdleRcvAC97SLabsEnableCallerIDCAcadiaCheckErrorx_memsetV34TxDataDataModeCodecBufferHandlerPCMClientDemodulatorSetShortEqualizerV34P2L1L2XmtSetModepacket_countCAmrALiBufferHandlerV29InterpolatorV32InterpolatorTimingPhaseTrackingEnableV8ControlFindSelectedModulationFromJMDataLXRegistrySetValueDatamemcpy4to2GetMseThrV34PllDelaycCoded12000MapBlockCplxConvolveCAmrViaCloseMnpBreakRcvV34DemodulatorSetRcvOnlyModeV22DecodergV21OrgSupressorCoeffsPCMClientInterpolatorAdjustTimingAC97SLabsA2DisableCallerIDUART_xoff_offCSV92PPSpeakerLXModemPerformTXV34Phase2CommandHandlerAC97IntelWriteGPIOBlackListingInitV34InterpolatorRestartRecoveryMnpAsyncXmtFrameHandlerFRSHandlerA3PolCheckLoopCurrentProtocolResultCodeCmdPCMClientFrontEndGetMagnitudeScaleFactorSMInternalReportVersionNumberBPFResetSilabsChangeHwConfiggHardDefinitionTableV32DescramblerVoiceCommandSnooperSL3026CheckLoopCurrentFromWatchdogCAzlIntelConfigureCountryV32DemodulatorTweakPllPhaseV34Trellis16WalkBacklin_pci_dev_get_mmap_0V34InterpolatorFIRAmpersandBCmdUsbMerShuntControlgConvert8000To7200FIRMnpAsyncInitx_usb_submit_urb_atomicV34TxDataResetV29ControlXmtInitV22ModulatorEnableGuardTone1800HzV34FrontEndSetLongNeecstrcpyV34TrainingDecoderV32DiffDecoderSetRateV22ControlTxR2At1200StateV34InterpolatorDisableTimingPhaseUpdateLapmProcessIFRMATCommandDialInitMnpSetTimersPCMClientDemodulatorAdvanceWritePointersResetSaveDataFlagUpdateVASTblCodecSetModemV24LapmTxDataHandlerV253ReportRingEdgeV27EncoderSetModePciCfgReadDwordResultsTypeCmdCAcadiaSetWakeupStatePPDMABlockByteClearSpeedAdjustCmdV34RxDataSetDataModeV34P2ControlOrgRxDetectPeriodicalB2213Statelin_pci_dev_get_base_0V34DataAssemblerResetdaSoftModemConfigureCountryV34InterpolatorFIRResetV34RxDataDataModeV44InitPCMClientSaveneecCoefBufferV34Phase2InitPCMUtilBuildDemapsV32DemodulatorCalculateErrorV34P2L1L2RcvPCMViterbiSetPredictorV17FrontEndGainHitCAmrViaBufferHandlerMnpComprEncFlushdp_dl_mainV29DataPumpXmtV90ClientControlCheckClearDownuI2LinTblSetDilTimeOutModemRegOut16LapmDetectorFinishSetLUCountryCodeMnpInitLTAudioTimerdcloop_stableDumpV90CpV34InitV92DataModeEncoderSendSilenceSmpModemReset