ba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!      edcba`_~}|{zyxwvutsrqponmlkjihgf+/mntFDU++++A +++C0++ +mA0+++mA0+++mA0+++mA0+++$+++A+++Ɂ* +"+ +Ɂn9 !"+ "+ +ɁR()*+,+ "+ +ɁJ-./01234567+ "+ +ɁP^_`abcdefgh+"+ +tu++ + vwxyz{|}~G+"+ +ɁG+"+ +Ɂ"+"+ +ɁG+"+ +Ɂ.H+6"+ +Ɂ+:"+ +Ɂ#+K"+ +Ɂa+X"+ +Ƀ~\"+\"+ +Ɂ>d !"#$%&'(a"+a"+ +Ɂz9J+g"+ +q+q+ +A@:+ ++A;+ ++Ɂ6<=>?@ABCDEFJ+|"+ +Ae+++fJ+gݤ+ +jughijklmnopqK+"+ +K++ +Ap+ ++>L+(+ +jK++ +K++ +FL++ +K+"+ + K+d+ +0J+J+ +/K+"+ +ɁHK+"+ +AP+++AP+++ɁR"+"+ +AP+++AP+++Ɂ "+"+ +Ɂ8"+"+ +Ɂ(%&'()*+,-./L+"+ +Z1L+fݤ+ +23-+-+ +4L+*+ +E56789:;<=>?M+2+ +@}HIJKLMNOPQR"+"+ +ijkM++ +*lM+fݤ+ +xmM+)+ +ɁVnopqrstuM+"+ +Ɂ^vwxyz{|}M+"+ +~M++ +jM+gݤ+ +ɁM+ #+ +hM+ #+ +ɁJM+$#+ +ɁB!M+%#+ +-M+hݤ+ +ɁM+'#+ +M++ +A@+++N+%+ + "+"++ ++ +A0!+ + +AP"+ + +#$%&Q++ +]'()*+,Q+x+ + -./0Q++ +A@1+ + +234567Q+x+ + 89:Q++ +AP;+ + +@ <=>Q++ +?@ABQ++ +5CDEFGHIJKLMQ++ +ɁRSTUVWX4+"+ +AY+++A Z+ + +A@[+ + +AP\+ + +A ]+ + +A ^+ + +! + + +! + + +! + + +! + + +!. + + +!. + + +! . + + +!. + + +$!2 + + +$!2 + + +$!2 + + +! + + +!" + + +$!" + + +$!" + + +! J + + +$! @ + + +$! + + +$!  + + +a@ + + +!@ + + +! + ++! + + +! + + +! + + +a  + + +a  + + +a  + + +a  + + +a ' + + +a / + + +!  + + +!  + + +!  + + +!  + + +! ' + + +! / + + +a` + + +!` + + + a + + +!  + + +! ( + + +a( + + +a ) + ++a *+++a ++++a ,+++a -+++a .+++a /+++! /+++...tmp binusretcHshlib_instscript`rootlist_uperootlistfhdiskkinst1ninst2sdevwlibxmnt..._lbl...prd=unixos...typ=ku386...rel=3.2.4l...vol=N02 ... basename cat chmod cpiodddirnamedparamduedredexprlinemkdirrmsedshrshsttySTTYsynctruei386tset9telinitdf.flddfL+ 4L p@.textpp4p .data@@L@.bss@@ .fka000C".fka040@@LB.fka041L@L@.comment".lib @@@ @ @@$@@(@t@,@x@@ @@@4@0@@8@@ÐET@RU RPch@jL@ PjU SWV}}3 @yh@j  @@jmE p F~/u>u}~/E XC;uE 9Xs KN8u;wE 9XuWbj ^_[ÐÐT$ÐUu1@u3Uu@u3ÐEÐU=@ uÐ@M l@@3ÐUV5@Ny^Ðl@Ny^Ð@@t@@@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL+ !p,@.textppp .data,@,@!,@.bss4)@4)@.fka000C".fka040@@LB.fka041L@L@.comment"49.libV9@"@@@!@4@0@<9@8@-@@D/@@L3@ @T7@$@#@(@'@,@'@@ ÐET-@RU RPWh,@j L@ P8jUTSWVEEEhH@j hL@u uG @tWǃ?tMet@st#tt.ut vt5jh$@볐4@8@<@@@E܃}t%=4@uhT@h$@jaEP$@P } =4@u ht@j)@@9EuEE@@E _h@E 0 =4@u(E 0h@P PE@@E @@9ED$@ 7}uE ;-s{i#@EPF P }=4@uE 0h@ff]ff thf`tafEf9EuWfEf9EuM=4@u(}t @E Ph@h$@ V h@=8@t V VEԁ#@h$@V =4@h@h$@X$@% D@ t0=4@u Ph @h$@; h# @`Eu^_[ÐUWVEp D@E}=D@t-+=D@D@EWD@D+@Pj D@;uʃ=D@u9=4@u%uuh$ @h$@hR @^_ÐhhD+@V S3^_ÐUVEyu EH@@C"@Wv[ $@yh$@jMM $@$@ $@yh$@j-W- $@$@"@  uT=@@t+ $@yh$@j$ $ $@$@ $@xoƋ $@$@ t u =<@t< $@yh$@j^^ $@$@ }F@? $@yh$@Pl3^ÐUVh @=L@| @9L@} L@4p @}tE8tPhT @h$@ 5L@Vh @u \ @d @Ph$@V^ÐUWVj*ju 3U}#E kME 8GE"@u؋E8u3^_Ð t t5$EE8_u F}/3뼐Ex.t ^_ÐFܐEE8.t䐐^_UWV3%kE<8ujE PEP; F|^_ÐUjh@j u MPu jv jh@je E.$D E @u Pu j+ j"h@j jh@j jh@Րjh@j jh0@j j h@jh0@j jh(@륐jh<@낐jhT@sj hh@g  , , jhv@jZU4hx@u uE0@uu t ÐE8txt x>u E t1EPub tu j5EPuE8txt xh|@g E t0EPu tu jEPuE8txt xh@ t$E8uxu xu jEh0@E EPui tu j<}t}t}t܋E8tEPum tvExtEPEP= tFExtEPEP  tEPuOE}jP}u u j]E8t xtxu EPh0@TEPu3ÐU=D@|5D@A}t juD@ } Ð3Ujj5D@ Eu"Ehh4)@5D@ E ~3E4)@EEE8 t EM}u}u2}4)@u3Ðju5D@$ }tEEÐEE+E@Euuu tME@EwUVEPkEH<@u , t3^h@EPE-h@EPjkEDPEPs E}|h@EPekEH|@EPOjEPY|@u)}tkEH<@j6Q@^jEP|, |kEHM8x@t(kEH<@j||kEHp@E|}tkEH<@j^kEH@@jEPVY h@kEH@@PNjEPkEH@@P* h@kEH@@PjEPkEH@@P HE@@^ÐUWVEE4*@} }3g4*@^_Ðh@h4*@kH@@Ph4*@kH@t!@P@@P tEFkH<@u}t@@^_Ð3kHE98@u @@^_ÐFkH<@u3^_Ð}hu h4*@, B+@=4*@/uEE5*@E4*@3juV E tF}u$}t*EEj/PE tEkH<@uE ^_Ð3FkH<@DkHM98@uju VJ ^_ÐUV}|+EERkH,@^Ð@^U}uuj t3ÐU츟@ÐUhD=hu=t3^_ÐV|$3O|$ L$Oϋt$ +D$^ÐUhPu =|hPu =}hPh"@{ hPh!@b 3ÐWVt$ |$;t1L$AIt)u*t!ItutItut Itu u3^_W+^_ËV|$3O|$ ыt$ D$^W֋|$ 3ыt$ |$ȁD$_ÐT$rÐUu1@u3Uu@u3ÐEÐU=0)@ uÐ0)@M (@0)@3ÐUV50)@Ny^Ð(@Ny^Ðusvteusage: cat -usvte [-|file] ... cat: cannot stat stdoutrcat: cannot open %scat: cannot stat %s-cat: input/output files '%s' identical cat: close errorcat: close errorcat: output error(%d) cat: output error (%d/%d characters written) %s: %s %d %s Error @ @ @ @ @( @4 @P @d @x @ @ @ @ @ @ @ @ @ @( @8 @H @X @l @ @ @ @ @ @ @ @@@$@<@P@l@@@@@@@@0@@@d@@@@@@@@@@$@<@T@`@l@@@@@@@@ @0@@@\@l@x@@@@@@@@@ @8@`@@@@@@8@P@l@@@@@@@4@X@x@@@@@@,@P@l@x@@@@@ @ @0@D@\@h@t@@@@@@@@@@@@@@@8@D@T@d@t@@@@@@@@@@@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too #$%&'many symbolic links in path/etc/default/langLANG=H@english_us.ascii@PT@\@english_us.ascii$h@p@english_us.asciix@@english_us.ascii\P@@english_us.ascii@@english_us.ascii,h@english_us.asciiLC_CTYPEctypeLC_NUMERICnumericLC_TIMEtimeLC_COLLATEcollateLC_MESSAGESmessagesLC_MONETARYcurrencylibc: setlocale: : LANG environment variable syntax errorunable to open no line in syntax error in cannot open locale filecorrupt locale fileunknown error CLANG/usr/lib/lang//_./      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~yn-$ +29AKT[dhlptx|%m/%d/%y%H:%M:%SAMPM%a %b %d %X %Z %YSundayMondayTuesdayWednesdayThursdayFridaySaturdaySunMonTueWedThuFriSatJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberJanFebMarAprMayJunJulAugSepOctNovDec  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ ((((( H d7@d7@'@l7@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL+   p @.textppp .data @ @  @.bss@@ .fka000C".fka040@@LB.fka041L@L@.comment".lib:@ @@<@@D@ @L@$@ @(@@,@@@ @@ @4@0@4@8@ @ÐET @RU RPWh @j;L@ P$jU WVE}}h0 @h @"h6E @@W @PcPW@u Wht @&F9u~2E @@lrthstwtYxt\ @E}tfEf%f=@u 3EEE#ߋƃ+t[-R=Af$뺐˒봐IE륀E듐 E녀}}uR%uF}ujh @jjhfEf%f=uu h @jjFE^_[Ð}uN%=u@}u%ujh @jjfEf%f=u u h( @또}u*fEf f#f%HρH;t u h\ @e}|E$<ou h @A}u}ufEf%f=t}u}ufEf%f=u}}%8=8t% = fEf#fEf%@f=@tfEf%f=u^u h @jj%=tE%@ρ@;u%=tE%ρ;u!Em}u1%ujh$ @jjv%8=8te}u&%HρH;tjhX @jj8!E ] D@@8,$ @@8tjh @jjE^_[ÐUWV370@@00}@8tjh @jj^_ÐUV3 @@at/gtotut u^Ð8Ɓ뾁U@+t -t=u@@Ð3UE4 @h @h @b uuh @O } t u ÐÐT$ÐUu1@u3Uu@u3ÐEÐU=@ uÐ@M @@3ÐUV5@Ny^Ð@Ny^Ð @ @ @ @Usage: chmod [ugoa][+-=][rwxlstugo] file ... can't access %s can't change %s Group execution and locking not permitted together Group execution not permitted on %s, a lockable file Set-group-ID and locking not permitted together Set-group-ID not permitted on %s, a lockable file Execute permission required for set-ID on execution for %s Locking not permitted on %s, a group executable file Corresponding set-ID also disabled on %s since set-ID requires execute permission Group execution and locking not permitted together Execute permission required for set-ID on execution invalid mode invalid mode ERRORWARNINGchmod: %s: ((((( H \@\@@d@@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL+ 8p@.textppp .data@@8@.bss<@<@.fka000C".fka040@@LB.fka041L@L@.comment".lib2@D3@@@d0@4@0@[@8@@@Q@@U@ @Y@$@6@(@:@,@:@@ ÐET@RU RPWh@j{KL@q PjU4F@=4F@t"Ef@f4F@Eff6F@4F@ÐEff4F@Ef@f6F@4F@U,SWVfEE 0GAh@<j@Ajj E @8-t1\fQ@j#f<@5E6@.$Hf8F@f@F@ @5H@@ hph@?5H@uh@j;5H@ @ u*hxh @?5H@uh@jN;fE^fF@iNfHF@@fF@o2fF@p"fBF@fK@f$B@fLF@fVF@fF@h4@h@@,B@h6@h@@h@@h@@j[: of:F@f\F@ fNF@f&B@AfK@4fTF@(fF@f<@f<@H@<@fP@`F@Pu5F@ 54@j5H@;4@tch\@NF@Pu5F@ 58@hh5H@8 ;8@thd@5H@ H@F@+fJF@fK@`<<<<<<<<<<<H0<<<<p<XHP<<<<<@<<<<<<<<<<0,<<<<<$T`< <l $0h@u u{ E@=@f=F@iu@hl@8-f=F@pu@h@-f=F@ouYf @tNf}t hh@;5 @h@hh@};5 @h@j7 F@it1ottph h@<;h@j6f=$B@t h@@`,hj/F@f=F@pN B@ hF@58@f=JF@t hp@,f=@F@th@댐f=F@t!hh@:h@j,6f=JF@t h@+f=@F@t h4@+= @*hd@}+ @ B@= B@~L B@- @PF@ tԣF@F@F@ B@- @F@F@F@= B@}h@*jy@@)EE F@ } f=Q@uhF@h`F@+ hG@ uCf=BF@tG@LPh<@G@-F@ G@PhF@Xf=Q@u.jh G@PF@ }h G@h@*;f=BF@tG@LPh<@G@-F@ G@PhF@pf=Q@t;h5F@h G@a E } h G@h@u5F@=hG@E^E=|L@V5F@5PF@ }h G@h@5)V5F@m}5PF@f=8F@thtF@h G@f=<@th G@h6@c(G hP@h G@xfF@qfF@4F@=4F@t 4F@f6F@fG@f4F@4F@f4F@fG@f6F@fG@h\@ f@fG@f=BF@tj G@LPh<@G@-F@ G@PhF@\}~jh6@VE L@fBF@&jjt Ef=TF@t h G@)f=@F@t h G@)h G@TfEf t f=K@uh G@`XF@ XF@hG@Ef}t)9E}$3XF@fEE+EPh G@hh@& Ef=BF@uEعu 3f=Q@^L@EPu5F@^ @u h G@h@&F@ EF@f}f=K@h G@5F@7r h G@$ u3h G@5F@ r h G@h@%h G@h@=XF@tzf=&B@tV5F@L@V5F@5XF@ E;}; EEuh G@h$ @%=L@t =L@m}~IE=|L@EPV5F@ @9h G@h @ %=XF@5XF@jM)L t=<@ F@#0jUs`h G@h8 @$HF@Ph G@jd) hG@PhG@Ph G@7 f}f=<@tGf=K@t)f=Q@t5F@h G@khF @h G@h6@#f=K@tCf=Q@t,h6@h G@h6@hH @5F@h G@-  @9F@F@+5 @)F@}tjE 0AJ@u&hhP @ 2E 0hX @j- E 0h0B@hF@h0B@j & fF@f%f=@t&hhp @1h0B@hx @jL- fF@f K@h0B@/B@/th @h0B@ih0B@p0B@ f=Q@tf=K@uh G@h @l"h G@O  t3C G@/t G@PWf=LF@7f=Q@)f=Q@f K@f9`F@h0B@h G@L L@t$h0B@h G@h @! %h0B@J  t_h0B@h @!h0B@ XF@ jh G@j$ PF@ 5XF@h0B@h G@K h0B@h G@h @Vh0B@ }h0B@h @[f=Q@Uu5F@h G@X E } h G@h4 @.EF@h0B@5F@l }h G@hT @ Nf=<@>h0B@h6@אpF@EU=XF@t/L@V5F@5XF@/ } h G@h @cF@m}~JE=|L@V5F@5PF@G oh G@ht @5PF@>f=8F@thtF@h G@=XF@5XF@F@Ph0B@j,$ hG@P5tF@h0B@ f=<@h0B@h6@si#o*pm<@F@F@- @ Ph @5(@=m^_[ÐUh @5@h @5@h @5@h\ @5@h @h @%Uf}u;hh @,E P} Iu ioPh @j(} Iuf}iu } Ou2f}ot+hh( @,EPE Ph0 @jA(}t!hh\ @y,hd @j(ÐUhh @R,u uh @j'ÐUWV>@h6@hV' E u 3^_Ðh6@u_V=vhVh @$ 먐>.t3>u @Vh G@f=$B@t!h`F@Vj~/uF>/uh`F@Vj{ Ef=dF@f#=P@f@ffQ@f`tf tfuff3fQ@fffQ@fF@qh G@f@fG@fhF@fF@fjF@fF@f`F@fF@fbF@fF@fdF@fF@4F@=4F@t xF@4F@f6F@fG@f4F@xF@4F@f4F@fG@f6F@fG@ffF@fF@fF@f%f=t f=Q@tpF@3E4F@=4F@t4F@f6F@fG@f4F@E4F@f4F@fG@f6F@fG@flF@fF@f=BF@t u^_ÐUh G@uh G@@P5xF@lF@PfF@PjF@PhF@PdF@PbF@P`F@Phqh @h<@FÐUh(B@hG@hDF@hF@hF@hF@hF@hF@hF@hF@hF@h4 @h<@R44F@=4F@t!(B@4F@f6F@fG@f4F@(B@4F@f4F@fG@f6F@fG@4F@=4F@t'DF@4F@f6F@fG@f4F@fG@ÐDF@4F@f4F@fG@f6F@fG@UVhd @h G@4 u3^Ðf5F@f#5P@f@ffQ@f`tf tfuff3fQ@fffQ@^ÐUVu5L@V HF@3t3^Ðf=F@f=Q@Vhp @5u @f=Q@f=K@t8f=F@u.h @V2 u f=F@th @Vx2 u 3^_[ÐhF@V-'@<@PdEhVB t6E}} V tjad}uVh @)Eא}Vh @ؐf=F@~SV  GhF@V}& urf=F@t8F@t f=Q@t f=Q@uVc }Vh @f=F@u&hG@;F@Sh@.?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]@t5 @ @;@vjO@>5 @5F@58@y @uL@tt>Yj؍ @F@)F@; @uEF@5@h @P jZh@9 jZ뚐 <@F@+F@E;|ljEPV5F@ +}uEF@F@^_[ÐU @F@0@j5F@=F@uÐUu58@jE 8@L@T@5 @5F@P E; @u T@Ðh@  `@뒐USWVu} =d@uh@h jJ0h@9l@u'h@kh@P5d@j d@3QE0}uWuh @ 3^_[ÐhG@PhG@PVC;l@d@Ef F@f9Huf F@f9uf=<@uWPh@ f=<@tf=F@puWh6@H Vf=F@iu0Ex/t'<@ƀ0B@EPh0B@1E0B@EEEVu4 E}} W tփ}Wh@_ WPj  l@d@ u2=p@t5l@h8@p@^_[Ðl@ d@f F@fl@ d@f F@fHWl@ d@P7l@UVuF@PhT@fF@f9t@uK@0h\@[/F@P/K@ t0hd@[fF@ft@F@Phl@7ft@hG@@Pht@hG@%4F@h4F@2Ph|@hEP+VEPh@ E 8tPh@h@^ÐUV} uI^Ð>/u~t Ff=@F@u>!uFPu  tVu  uE E 0 u3^USWVu} }uf=\F@uf=NF@ǹ t>GF^O uf=NF@*}EEǹU tU¹ t&GEE+E;E|-EE吉}EEE+E;EG%EffEEfIfEfMfHEO u^_[Ðf=:F@tnuǹU t} EEE+E;EG%EffEEfIfEfMfHEO u^_[ÐUVuf=VF@tE K@EK@hK@V^ÐU(VL@EPu ff%f= tf}tI}uCEt+t.hh@Sh@j h@h@h@njR}t}}t }="u VF tא^[ÐUEEEE@Eh6@hl@ =@t+=@t"h6@5@h6@j uuh6@F h6@j h!jdkÐUEE@h|@Puu 5@ =@=@th6@j6=@t+=@t"h6@5@h6@j =@t7=@uh@@ t5@h@h6@ =@t!=@t5@h@h6@ =@tS@EEE8u+@;@~h6@@ @4 h6@h@A=@tZ=@t,} u&h6@h@E(uu h6@D h6@h@=L@tZ} tT=@t=@uB=@t =@u0h6@j h6@qh@&E=@=@th6@j Qh6@h@E=@th6@5@)=@t5@h@h6@ }t5L@h@h6@ h6@j =@u =@t3=@t*=@t!=@u5@h@h6@ 5@uu 5@ P?ÐU EEEE@EEE@EuPuU EEEE@@@EE@EEE@EuPuUÐUWVu VPhx@PFh@ u=@@@@@@@@h@; u=@@@@@@@@h@ u9@@@@@@@Sh @ u @#h@s u @h@O u @h @+ u @h(@ u @h0@ u @oh8@迿 h@@褿 BhH@艿 u@hP@c u @h\@? u @hh@ u @hp@ u@h|@Ͼ u @^h@课 u @>h@菾 u @h@o u@hx@jb t=h@W; @@@@^_UE@E @ÐU SWV}u K@E u3^_[u V;?tu W: u  K@ C K@^_[ÐUE@ÐU@EE@EÐUEUE tt tt,øÐdÐUEdt=uÐ5@>U$K@|ÐU=$K@uyL@EhDj 蘼(K@u uE=$K@|t$K@_ tL@E5(K@j PEL@=$K@|tEÐu u$K@ÐUVH@=L@|@9L@} L@4P@}tE8tPh4@h6@ 5L@VH@u <@D@Ph6@ں^ÐUWVj*ju J 3U}#E kME 8GEE3@u؋E8u3^_Ð t t5$EE8_u F}/3뼐Ex.t ^_ÐFܐEE8.t䐐^_UWV3%kE<8ujE PEP1 F|^_ÐUjh(@j u ѺPu j jh(@j E.$GE (@u 膺Pu j诺 j"h(@j螺 jh(@j膺 jh%@Րjh(@jj jh&@jY j h(@jh&@j> jh)@륐jh)@낐jh4)@sj hH)@gGG8GTGGGGGjhV)@j޹U4hX)@u船 uE(@uu t ÐE8txt x>u 膸E t1EPub tu j5EPuE8txt xh\)@)E t0EPu tu jEPuE8txt xh%@ t$E8uxu xu jEh&@E EPui tu j<}t}t}t܋E8tEPu tvExtEPEP tFExtEPEP葷 tEPuOE}jP}u u j]E8t xtxu EPh(@TEPu3ÐU=$(@|5$(@ŵ}t juz$(@ } Ð3Ujj5$(@# Eu覶Ehh,K@5$(@; E ~3E,K@EEE8 t EM}u}u2},K@u3Ðju5$(@訵 }tEEÐEE+E@Euuu tME@EwUVEPkEH&@u , t3^hd)@EP貵E-hr)@EP臵jkEDPEP35 E}|ht)@EPVkEH\&@EP@jEPݴ|@u)}tkEH&@j6Qv)@^jEP|谴 |kEHM8X&@t(kEH&@j|虳|kEHP&@E|o}tkEH&@j^kEH &@jEPV4 hx)@kEH &@P?jEPkEH &@P3 hz)@kEH &@PjEPkEH &@P3 HE &@^ÐUWVEE,L@} }3g,L@^_Ðh|)@h,L@莳kH &@Ph,L@xkHd&@t!h&@P &@P^ tEFkH&@u}t &@^_Ð3kHE9&@u  &@^_ÐFkH&@u3^_Ð}hu h,L@) :M@=,L@/uEE-L@E,L@3juV E tF}u$}t*EEj/P~E tEkH&@uE ^_Ð3FkH&@DkHM9&@uju VJ ^_ÐUV}|+EERkH &@^Ð~)@^U}uuj t3ÐU)@ÐUjju uUjuu uÐUSEEEEEEM8E 8EPEPEP EEPEPE P EE)@EE)@E:t E+[Ð}uEE)@M M)@+E}iM`3[ÐEM8u3EPEPEP EE M8u3EPEPE P E9Et E+E[Ð}tE[UhD=h:t > tF>u> u ^Ð>tF^ÐU=\0@u hb0@hP0@*\0@ u3Ð5\0@UVuhht>:t5@Q@V>t5DQ@V>t>:kj EPV Ej:V-;EE}| }`~aEHQ@V>>: j EPVs Ej:Vˢ;E}| }`~ aELQ@V">5TQ@5XQ@V>>:5\Q@V>k5`Q@V5DQ@>,tF>u>tF5PQ@@Q@^ÐÐ l3Ð[TÐP@Ð,3ÐUu PPÐU,SWVE+0@E؍EP=0@tw) E u#0@G$j 50@G(P ^_[á0@+0@EwEPW؋EPWEEعQU }EQE@+EE } MEQ;;uEM9H3E9u 9uuE9E} 3E9]| }t }u}tG  tEE؍EPG 0@0@G$j G 40@USWVu ~}~-vu);~؋FF;~^_[ÐUWVu} :|v`-mF+F+^_ÐUSWVEQUEE}} EQME<Q@EQ@Ǚ=Q@EpQ@}|)FGW;E/W)E㐐FGP{EO}|=Q@u5Q@WY=nu p0@3+Gl0@;~p0@FQ@=Q@Q@Q@h0@hQ@WQ@^_[ÐU SWVdQ@1@GF uEk@ǰ1@dQ@GFGFGFF]k1@GFGFGF3VdPVdPVdPV~Exd|F2F0E@dPVUdQ@^_[ÐUVuƹ uƹd uƹ u n^Ðm^UVuF} |E 0 FE 0F^ÐUVh1@  t>t =1@u"hQ@hQ@ @1@30@0@ >0@h0@50@Vw >@0@ tC0@-0@h0@50@VC >;t>,u151@V^Ðh0@50@0@^USWVu} 3+E3@u+>-t&>+t!>;t>,tC }F>u C|3ۀ>- u>+uFuV tE^_[ÐUWVuu  u0@VWw0@_^VWw0@_^0@G'GPFV>,uGPFV^_UWVu} k 0FE3@u^_UWVuEE3@tEPViE>:u.EPFVkE<>:uEPFVk}}tE 8^_ÐU VEJ0|994EPuE}|}lE MHE @E x|2E8.u*EPEuE}|} E MHE8/uu EuEE^ÐEPEuE}|}mzE MIaEPEuUE}|}4E kMIH}5u E @l}$}5E @ 3EPEuEMEE ~  E4l0@MyE8.u9EPEuE}|}kE}u E4l0@ E NH^McW_UVEl0@ 1@sF9E9E|^Ð3^ÐU SWV=1@ukj_Q@P?Q@ u(h)Q@ u3^_[ÐQ@<Q@Pj5Q@ 1@EPj |E Et+Q@PޕQ@Q@;wҋE 8rEW豕u覕ujS, S菕juh2@h2@h1@j!}Q@M SKu W^_[ÐUWV=1@u ^_ÐEp PjjEjjEjjEu =L@uEP=Q@;ÐUWVu  u3^_G EG G 3ɉOO :@at%rtwt*ÐO ~+ug O ^_jju耔 O א*hL$Q3Ð\HÐUVuV豓jjF P" FFf F tf ^ÐUE EE Puh6@cÐUEEEPu uEÐUVuEEEuuV1EEt%Q@y V FFE(jWF P uEEQ@EE3@t5E} Q@VEPMf]mY Q@VEP Q@VEP- Q@VEPkEFFMxlE;sL@"3^_[E3@u}E3@E3@tCE3@t7W+؉EE9E|h}}}6EPZ]}t E]}lE@VWu_^3}t}u EmEEE܋êQ@V}R;@;u EE tet E/}%EE êQ@yV踋 FFE3@g+^-UE3@CE@EE}t }t]}lt}huE@fMfE@M Q@VS; @u Q@E^_[ÐU SWVu} ] tE@3EEcu uQ@Ey u衊 EH@E@t5su EE3@u$[u EE8u tEMEK }uQ@ Q@& ~! Q@uuS @u Q@E9Eu3^_[ t ctE^_[ÐUSWVu} E>^uEFh}PWNJ E]t-u_EM FS}u 3^_[Ð}-u2E]t'F;]}E+@PuPf 붐EM FFE]u^_[ÐU SWVu3ۉ]]]F>E3@uǃ+t -uEFEEF~E3@u.uVEE uLF~E3@t>+]0} } mE}붐E}  kE ljECM뙐}u2@^_[ÐEEEteucEE t +t-uEF>E3@t3}} kE ǃ0EF>E3@uރ}t+]]uSuuuG^_[ÐWV|$L$3ыϋt$+΋|$ ȁ3D$ ^_ÐU8SWVu}6~L@"}2@^_[Á}}L@" 2@^_[Ð t}+Ek P5@E?##@EE@M EEE؋E@؋EEp +ƉE~EE]3m}ueeEu %?ME%?E޸F+EEE?EEE؋??e?e?.E???3EEE*E u$]EEEm␐E} E |E)EMeeEEE؋E?e?e???+E P+Ek H4@E@EE@EEE܋E@E؋E@MMMMMMMMMMMEEEԋE@EЋE@MMM؋EMEE@ E]EEEE?E%?E%?E?#߿?#+E%k P5@E@EԋE@E؋EE܋E@EE@MMMMMMMMMMMEEEE@EE@MMM؋EMEE@ EE?E??EEԁ |ME+EE } EE}IEM E̋K EԉE u5 t1E̋Efs"L@"}2@^_[Ð}u E^_[Ðuuu ^_[ÐU}tE(2@uEÍEPu u虂 P@}~B} EE=~TL@"E(2@s 02@Ð82@Á}| EE=}L@"(2@uu u^ ÐUSWVu} C;t8u;t^_[F~u3^_[ÐUSWVu ] G?t8u?u +E^_[ÐC;tېUSWVu}E} tE 0 |$~ 3^_[ÐEE3@u, FEEE3@u+t-u EFE u&}0t ~xt~XuEE3@tE3@t0EE3@tW E7E;Qu(}0u"FE3@t~xt~Xu EEE3@t0EE3@tW E7؋FEE3@t/E3@t0EE3@tW E7E;|} tE 0}t^_[Ð+E뛐^_[ÐZ0ÐD$Pt$Ð5@t$ t$  Ð;~~t3ÐV|$3O|$ L$Oϋt$ +D$^Ð T$tÐUhPu =|hPuv =}hPhD3@' hPh@2@ 3Ð?}Ð<}ÐUVu }u ^ÐF tF9FwF9Fu߃>uF~u V}NFME^UVE@ u @ t H uuu @} E@ t ^Ð^Ð}L$tÐUEEf%Etf=Du]Ð%|3ÐÐ|T$|ÐUu1@u3Uu@u3ÐEÐU= <@ uÐ <@M ;@ <@3ÐUV5 <@Ny^Ð;@Ny^Ð@/dev/ttyLChange to part %d and press RETURN key. [q] notag,notofixaABK:C:ifopcdkLlmrSsbtTuvVM:6eI:O:Dcpio.cIllegal argument to -%c, '%s'.cpio.cIllegal argument to -%c, '%s'.rwcpio.cCannot rename (%s missing)inputoutput`K' option is irrelevant with the `i' option `K' option is irrelevant with the `p' option cpio.cIllegal -C %x, must be multiple of 1kcpio.cMust use -C option with 1k multiple when using -K option`L' option is irrelevant with the `-i' option `k' option is irrelevant with the `-o' option `A' option is irrelevant with the `-o' option cpio.cPass and Rename cannot be used together.`k' option is irrelevant with the `-p' option `A' option is irrelevant with the `-p' option `B' or `C' option is irrelevant with the '-p' option cpio.cOptions must include one: -o, -i, -p.Not enough memory for buffers<%s> ? Cannot read symbolic link %s Cannot read %s. This file will be corrupted in archive. TRAILER!!!TRAILER!!!%s skipped: exceeds ulimit by %d bytes cpio: i/o error, %s is corrupt Cannot create symbolic link <%s> Cannot create directory for symbolic link <%s> cpio: i/o error, %s is corrupt Cannot write %s %s truncated -> cpio.ccannot write in <%s>cpio.c<%s> not a directory./Use `-d' option to copy <%s> cpio: cannot create directory for <%s>cpio: cannot unlink <%s>cpio: cannot link <%s> to <%s>cpio: cannot link <%s> to <%s>Cannot read symbolic link %s Cannot write symbolic link %s Cannot read %s Cannot write %s %ld blocks -p[adlmruvVL] directory collection%s %s %s %s %s %s %s %s %s cpio.c-%c must be specified before -%c option.cpio.c-%c option not permitted with -%c option.cpio.cNo more than one -I or -O flag permitted.cpio.cCannot open <%s> for %s.WARNING: Cannot archive %s, pathname is greater than %d chars. .%.6o%.6ho%.6ho%.6ho%.6ho%.6ho%.6ho%.6ho%.11lo%.6ho%.11lo%s%6ho%6ho%6ho%6ho%6ho%6ho%6ho%6ho%11lo%6ho%11loTRAILER!!!Rename <%s> Skipped .Same name ./....Cannot create directory for <%s>Cannot create directory <%s>cannot unlink current <%s>current <%s> newer or same age cpio.cAttempt to pass file to self!Cannot create directory for <%s>Cannot mknod <%s>Cannot create directory for <%s>Cannot create <%s>Cannot recover from I/O errorI/O error on read(). I/O error, searching to next header.070707Header corrupted, file(s) may be lost.Out of sync, searching for magic number/header.Re-synchronized on magic number/header.cpio.cThis is not a cpio file, bad header.cpio.cOut of sync, bad magic number/header.I/O error during rstbuf()Attempt to write past end of media after writing %d KBytes Please reissue the cpio command using -K with appropriate media size I/O error on write() Unable to write this medium. Try again. %s linked to %s Cannot create directory for <%s>Cannot link <%s> & <%s>No memory for links (%d) %-7o%-6s%-6s%-6d%7ld %b %d %X %Y %s %s -> %s cpio: ulimit reached for output file cpio: no space left for output file cpio.cwrite() in bwrite() failed Can't read input: end of file encountered prior to expected end of archive. wCan't open %s outputinputReached end of medium on %s. outputinputEncountered an error on %srIf you want to go on, type device/file name when ready. That didn't work, cannot open "%s"missing 'd' option cpio: cannot determine working directory, errno %d, Cannot get info about file:"%s"UXzlstat1Cannot obtain information about file: "%s".UXzstat1Cannot reallocate %d bytes.UXzrealloc1Cannot open file "%s".UXzopen1Cannot allocate a block of %d bytes.UXzmalloc1updatingreadingwritingappendingCannot open file "%s" for %s.UXzfopen1Cannot close file descriptor %d.UXzclose1Cannot change owner to %d and group to %d for file "%s".UXzchown1Cannot change the mode of file "%s" to %d.UXzchmod1Usage: , ERRVERBERRSOURCE%s: %s: HELP FACILITY KEY: , line %d UXerrno%dTo Fix: %s nochangesilentverboseexpertbellnobelltagnotagtextnotexttofixnotofixsyserrnosyserrdefsyserrsourcenosourcesevmsgnosevmsgprefixnoprefixRefer to help error database or manual. @@$@,@@@INFORM: WARNING: ERROR: HALT: %s: %s %d %s Error@@@@@@@0@D@X@h@|@@@@@@@@@@(@8@L@`@t@@@@@@@@@@0@L@`@|@@@@@@@ @D@`@l@x@@@@@@@@@4@@@L@`@t@@@@@@@@ @<@L@X@d@x@@@@@@@ @ @@ @h @ @ @ @ @!@0!@L!@l!@!@!@!@!@!@"@8"@X"@"@"@"@"@"@ #@0#@L#@X#@t#@#@#@#@#@$@$@$$@<$@H$@T$@`$@l$@x$@$@$@$@$@$@$@$@$@$@$@$@%@$%@4%@D%@T%@h%@t%@%@%@%@%@%@%@%@%@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in path/etc/default/langLANG=((@english_us.asciiO4(@<(@english_us.asciiYYH(@P(@english_us.ascii\RRX(@`(@english_us.ascii4QOl(@t(@english_us.asciiQQ(@(@english_us.asciiR@R(@english_us.asciiLC_CTYPEctypeLC_NUMERICnumericLC_TIMEtimeLC_COLLATEcollateLC_MESSAGESmessagesLC_MONETARYcurrencylibc: setlocale: : LANG environment variable syntax errorunable to open no line in syntax error in cannot open locale filecorrupt locale fileunknown error CLANG/usr/lib/lang//_./      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~yn-$ +29AKT[dhlptx|%m/%d/%y%H:%M:%SAMPM%a %b %d %X %Z %YSundayMondayTuesdayWednesdayThursdayFridaySaturdaySunMonTueWedThuFriSatJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberJanFebMarAprMayJunJulAugSepOctNovDec%cdeHIjmMSUwWyYaAbBcpxXnthrTD %I:%M:%S AM%I:%M:%S PM%m/%d/%y%H:%M:%STZ @ @pwd 2>/dev/nullr/etc/passwdrrGMT GMT 0@0@' ` / w / : /  M w /Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecTZ/bin/shsh-cGG  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ ((((( H @:'i _;?U3R)E?98p)D5} [%/ -I /wb5,6)6d>n G79 85q&5 1Z$.H+jt'!]6$J !5w%^_KLza N } dP@fff&h&QG!+ A j<h"2S58C7{-_k2+/4 U# >D K) m5\W?YU }?^Fz !%ph]( ZJ(9H/9Y!,Y@Y@:@Y@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL+ 'x't p( @.textpp'p .data( @( @x'()@.bss0@0@t .fka000C".fka040@@LB.fka041L@L@.comment"P.libP@\*@4@0@=@8@) @@3@@$7@ @,;@$@`+@(@ /@,@$/@@ @@P)@ÐET) @RU RPWh( @jL@ P4&jUSWV1@1@0@E'h8@ tOh1@C9]/E 0@h0@v th1@Ɛh@@N th}0@랐hH@& thU0@shL@ t0@0@ShP@ t0@0@3hT@ th0@ h\@ th0@hd@n th0@hl@F uht@5 thd0@h|@  th90@Wh@ Sh@ u0@8#h@ t Eǐh@ t E 뫐h@v t E돐h@Z tEph@: tEPh@ t 0@0h@ t 0@h@ t 0@h@ t 0@h@ t 0@50@h@h+@ j"=0@t0@1@1@=1@t =1@uh@h+@yjM"}u>=0@th@h+@Nj""=0@t 0@tE=0@u(E tt4tt6t= EEZ.$EސEҐE Ɛ0@tE0@E0@tE0@E0@tE0@E0@tE{0@kE_0@tEG0@7E+0@tE0@E0@tE0@E 0@tE0@E0@t E z0@toE f      |    x  D    H0@=0@tj50@0@G@j'0@uE8@9L@~ H@L@@P50@hL@h+@j0@=0@thh50@q 0@d@j0@uE8@9L@~ e@L@@P50@hh@h+@jT1@ P0@}t1@0@ P0@=0@t uh@h+@jjjhLj51@50@50@~ 0@u40@=0@~h@ j}2h@ =0@uh@ jА0@ 0@=0@o=0@t6j1@-0@P50@ @uh@e j=0@t6j1@-0@P50@b @uh@& j0@0@0@0@=0@=0@t0@0@;0@0@t/51@50@1@tN t NNKu51@50@50@ 0@uWh@e 0@t0@=0@~ =0@uj 6 1@0@#0@0@0@=0@E |[~|Q~tJ0@ t>O? tGKu 0@+H)0@0@/ 1@90@s 0@=0@ j =0@tU0@+0@0@0@ ~4E|%~|~7|~9 E EKu1@90@iP @EP @򐐐1@90@u 0@D0@0@t20@u)1@+0@51@50@NKu1@0@0@t850@0@t 0@0@@FFEFEFKu50@E9.$0@0@KuVPFGKu<PFKu&FF0 @Ku0 @PFKu0 @PFKuFF0 @KuP0 @FKuP{0 @FKuFF0 @KukP+0 @FKuOP/0 @FKu3  @`x1@90@r.0@ 1@+0@;s 1@+0@)0@0@E w.$Ku0@90@O? GP;FKuƐPGFKu벐FF0 @Ku렐0 @PFKu냐0 @PFKudKm 0@+H)0@0@ 1@90@s0@ s0@+0@;s 0@+0@)0@0@0@E 00@ E=0@t+FFE u0@KKu߉0@ t0@+0@@;s 0@+0@C)0@0@0@E.$FFE EKu[FFE PMGKu3FFE PEGKu FFE t0 @KuFFE t_P0 @KuFFE t7P0 @KuFFE t0 @KuEsFFE tPi0 @KuNFFE tPe0 @Ku*x0X}C0@0@+0@E0@0@ E|(~|~&|~( E EKuJP @EP @򐐐0@90@v!0@ 0@O0@1@1@90@)DDDDDDDDDDDDllllllUV50@M8t8t3^ÐEE8uN50@^ÐU VE 50@EE9EkE 0EF]*@uFF tp*tRbtEkt0wt3xt>50@hP@h+@ jo뺐e 벐e뫐e 뢐50@hLmEE9E}}uh,@h+@9 j E^USWV=0@1@90@r E0@0@E0@u50@50@ 9]t>1@90@r0@ 0@ 0@ 0@hl@jEE)0@50@=0@t=1@0@GFKu^_[á0@^_[ÐU uÐU50@50@h|@h+@50@50@h@h+@=1@t.=1@t@@P51@h@h+@UV@=L@|8@9L@} L@4@}tE8tPh@h+@r 5L@V@u @@Ph+@F^ÐUWVj*ju 3U}#E kME 8GE]*@u؋E8u3^_Ð t t5$EE8_u F}/3뼐Ex.t ^_ÐFܐEE8.t䐐^_UWV3%kE<8ujE PEP F|^_ÐUjh0"@j u =Pu jf jhD"@jU E.$TE H"@u Pu j j"hP"@j jht"@j jh@Րjh"@j jh@j j h"@jh@j jh"@륐jh"@낐jh"@sj h"@g0<<jh"@jJU4h"@u  uE!@uu t ÐE8txt x>u p E t1EPub tu j5EPuE8txt xh"@ E t0EPu tu jEPuE8txt xh@ t$E8uxu xu jEh@E EPui tu j<}t}t}t܋E8tEPu  tvExtEPEPV  tFExtEPEP&  tEPuOE}jP}u u j]E8t xtxu EPh!@TEPu3ÐU=!@|5!@1}t ju!@ } Ð3Ujj5!@ EuEhh 1@5!@ E ~3E 1@EEE8 t EM}u}u2} 1@u3Ðju5!@ }tEEÐEE+E@Euuu tME@EwUVEPkEH@u , t3^h"@EP E-h"@EP jkEDPEP E}|h#@EPQ kEH@EP; jEPI|@u)}tkEH@j6Q#@^jEP| |kEHM8@t(kEH@j||kEH@E|}tkEH@j^kEHƬ@jEPV h#@kEH@P:jEPkEH@P h#@kEH@P jEPkEH@P HE@^ÐUWVEE 2@} }3g 2@^_Ðh#@h 2@kH@Ph 2@skH@t!@P@P tEFkH@u}t@^_Ð3kHE9@u @^_ÐFkH@u3^_Ð}hu h 2@ 3@= 2@/uEE 2@E 2@3juV E tF}u$}t*EEj/PE tEkH@uE ^_Ð3FkH@DkHM9@uju VJ ^_ÐUV}|+EERkH@^Ð #@^U}uuj t3ÐU #@ÐUhD=hu=t3^_ÐV|$3O|$ L$Oϋt$ +D$^ÐUVu]*@t Y)@^ÐUVu]*@t Y)@^ÐUhPu =|hPu =}hPh\*@ hPhX)@f 3ÐWVt$ |$;t1L$AIt)u*t!ItutItut Itu u3ijklmnopqrs^_W+^_ËV|$3O|$ ыt$ D$^W֋|$ 3ыt$ |$ȁD$_ÐT$vÐUu1@u3Uu@u3ÐEÐU=0@ uÐ0@M 0@0@3ÐUV50@Ny^Ð0@Ny^Ð    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ibs=obs=cbs=bs=if=of=skip=iseek=oseek=seek=count=files=conv=,blockunblockebcdicibmasciilcaseucaseswabnoerrorsyncdd: bad arg: "%s" dd: buffer sizes cannot be zero dd: cbs must be zero if no block conversion requested dd: cannot open %s: %s dd: cannot create %s: %s dd: not enough memory dd: skip faileddd: read error during skipdd: cannot skip past end-of-filedd: input seek errordd: output seek errordd: read errordd: argument out of range: "%lu" dd: bad numeric arg: "%s" dd: write error%u+%u records in %u+%u records out s%u truncated record%s %s: %s %d %s Error<@D@P@l@|@@@@@@@@@0@D@P@h@t@@@@@@@@@@$@4@L@\@t@@@@@@@@$@4@D@`@@@@@@@@@(@@@T@l@@@@@@@@@@(@H@`@t@@@@@@@@@@@0@D@P@l@@@@@@T@|@@@@@@@8@L@l@@@@@@,@L@\@t@@@@@@@<@`@x@@@@@@@@@@@@(@4@@@L@X@d@p@|@@@@@@@@@ @@$@8@D@P@\@h@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in path/etc/default/langLANG=!@english_us.ascii<'`"!@!@english_us.ascii%4%!@!@english_us.ascii##!@!@english_us.asciil"`"!@"@english_us.ascii"# "@"@english_us.ascii<#x#$"@english_us.asciiLC_CTYPEctypeLC_NUMERICnumericLC_TIMEtimeLC_COLLATEcollateLC_MESSAGESmessagesLC_MONETARYcurrencylibc: setlocale: : LANG environment variable syntax errorunable to open no line in syntax error in cannot open locale filecorrupt locale fileunknown error CLANG/usr/lib/lang//_./      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~yn-$ +29AKT[dhlptx|%m/%d/%y%H:%M:%SAMPM%a %b %d %X %Z %YSundayMondayTuesdayWednesdayThursdayFridaySaturdaySunMonTueWedThuFriSatJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberJanFebMarAprMayJunJulAugSepOctNovDec  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ ((((( H <;@<;@ /@D;@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_s: # @(#) dirname.sh 23.1 91/08/29 # # Copyright (C) 1988-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # Copyright (c) 1984, 1986, 1987, 1988 AT&T # All Rights Reserved # THIS IS UNPUBLISHED PROPRIETARY SOURCE CODE OF AT&T # The copyright notice above does not evidence any # actual or intended publication of such source code. if [ $# -gt 1 ] then echo >&2 "Usage: dirname [ path ]" exit 1 fi # First check for pathnames of form //*non-slash*/* in which case the # dirname is /. # Otherwise, remove the last component in the pathname and slashes # that come before it. # If nothing is left, dirname is "." exec /bin/expr \ "${1:-.}/" : '\(/\)/*[^/]*//*$' \| \ "${1:-.}/" : '\(.*[^/]\)//*[^/][^/]*//*$' \| \ . Lc+  p@.textppp .data@@@.bss@@ .fka000C".fka040@@LB.fka041L@L@.comment".lib@@4@0@)@8@@@@@#@ @'@$@@(@`@,@d@@ @@@ÐET@RU RPWh@jL@ PjU$ th@h@(j}h @jME h@E 0 u'ME u uU t jk3jE 0DE@uh@j;ME u}tu uuf uujÐU5@h Du} @uh@.jÐU@9E tAh@h@j#EE0t @@E M u5@h Du @uh @ÐU0jh @E@u!h0 @h@ @h@K ÐEPuZ@uh\ @hl @ːuE uh @뵐uuu ;Eth @h @냐u}tE  @EjPDE@uh @hE u h @yhuu @uh @h@Y jhH @EPB u jhu @uhL @ jjut uuu+ @u hd @념u3ÐUh@h Du @uh @jQ@P@ uh @h@yj@@ÐU@@E!@@0h @E@9Er @yh@j Ð @@ÐUV @=L@|D @9L@} L@4 @}tE8tPh @h@ 5L@V @u @ @Ph@r^ÐÐÐT$ÐUu1@u3Uu@u3ÐEÐU=@ uÐ@M X@@3ÐUV5@Ny^ÐX@Ny^ÐOnly the Super User can run dparam Usage: dparam -w [partition] dparam partition [cyls heads wrt_reduce precomp ecc control landzone sectors]-wdparam: could not open special devicedparam:read ioctl faileddparam: invalid number of arguments for write dparam: write ioctl failed/etc/masterboot/etc/masterbootdparam: could not open %s/etc/masterbootdparam: could not stat %sdparam: could not malloc/etc/masterbootdparam: error reading %s /dev/hd00dparam: could not open /dev/hd00dparam: Could not mallocdparam: error reading masterboot sector ZZdparam: lseek faileddparam: error writing to special device dparam: size ioctl faileddparam: malloc failed %ld %s: %s %d %s ErrorH @P @\ @x @ @ @ @ @ @ @@@(@<@P@\@t@@@@@@@@@ @ @0@@@X@h@@@@@@@@@0@@@P@l@@@@@@@@@4@L@`@x@@@@@@@@ @@4@T@l@@@@@@@@@@@(@<@P@\@x@@@@@ @`@@@@@@@$@D@X@x@@@@@ @8@X@h@@@@@@ @$@H@l@@@@@@@@@@@@(@4@@@L@X@d@p@|@@@@@@@@@ @@$@0@D@P@\@h@t@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in path ((((( H (@(@`@(@@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL+  d(p0 @.textpp p .data0 @0 @d0 @.bss@@(.fka000C".fka040@@LB.fka041L@L@.comment".lib@T @4@0@ @8@1 @@@@@ @@$@X @(@@,@@@ @@L @ÐET1 @RU RPWh0 @jWL@ P<jUEMt~E @8-usE @xtgE RE afrsuhX @hx @jE 8uM}uEE @x @< @h@ uh| @hx @pjL8 @D @H @zL @nP @bT @VE E 0h@=H @tEh@h@" }#h@h @hx @ j f@f@h@JE=P @th@Ph @( EM b5@jMÐUVEEEEh@uh }%=L @tuh @hx @ 3^Ð=H @tf@f9@u=8 @uM< @8 @5< @5@t@ uh @hx @j=T @f=@f@f%f=@t|EE@ @9E}+u5@f@f9Fuf@f9u @ @ @f@f@ @ @f@fT@ @ 8 @5@Ef@f%f=@t:=T @tf=@=D @tuuh @; E^ÐuEEx/uMEEE}uCuwE u=L @Auh @'}tuuuE u6}t uE=P @WuuhD @?Ex tx .ux Vx .u x FE8~PIEuEE PE@=|h, @hx @jjFE/E PE@P@uEUE EE ~ @E} ~E- @E} ~EEÐU@|ÐU=@uyL@Ehj t@u ufE=@|t@h tL@E5@j ,EL@=@|tEÐu u@Ð[ÐÐUVuv V6^U(WVju } 3^_ÐEPWn |2fEf%f=@u$j thF u%fEf%f=@t L@W7두>3FF^_ø3ÐÐUWVuE~t~~ FEGFF9F|3FF~u+hv 6( F  uEF3^_Ð~~ ^_øQÐUVuV(;E tFju 6A F^UjjE0 u3ÐE@MA E@øÐT$nÐUu1@u3Uu@u3ÐEÐU=@ uÐ@M @@3ÐUV5@Ny^Ð@Ny^Ðusage: du [-afrsu] [name ...] .du: Unable to malloc space for link table. du: cannot stat %s %ld %s du: bad status < %s > du: Unable to realloc space for link table. %ld %s du: cannot open < %s > du: pathname too long%ld %s ((((( H @@@@@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL+ Tq  -p@.textppTqp .data@@ r@.bss@@ -.fka000C".fka040@@LB.fka041L@L@.comment".lib@ @@d@4@0@K@8@@@A@@F@ @J@$@@(@d@,@h@ÐET@RU RPch@jWL@m PojU0SWVu ]E;t u: u=*@?@>=?@j)3^_[ÍEԉE3|?@p?@E죴?@^u ?@=*@9uw j23*t\u*@{tu;u F^_[Ðǃ t9$*tY.t[\u\ =?@u=*@F?@^_[Ðj$2}tEE<t<tE/?*@;t1*@ {E@EE[^uEEЋψ]EEЋψ u j1A2[EEЋψ}@r j22=t.t :}EEЋψ}@r j21] u j119}uɋEEЋψ}@r j21&]uҋEEЋψ}@r j21]"EЋψE@j^E+PVEPRY ttFj2)1j$1 (tK)t~n{@019} j0$F+=p?@ | j+0EE p?@Fp?@p?@E9Ev|?@p?@9|?@t j*Z0FMEFE}EEE@tkE ǃ0E j/y\t,u΁}| j /EF,u$EE t j,/6\u+F&}t j-/}uEF=*@LF8Fj.=j$Y/ (^_[ÐUSWVu} =?@t5?@WVc^_[Ð?u;_;u WVA t5?@^_[ÐF~u3^_[ÐWV uF~uUSWVu} GG#w.$ G8Gt3^_[ÐF~tҐ>uȐ5?@^_[ÍEPPVWRZ tu@GG4?@끐GG4D?@nGEW?@ ?@ u*ޡA@ A@ t8Et=A@}F8Et4Wv?@ ?@ uޡA@ A@ tF~u믐F~uDP/&EPPVW^Y u졼?@ ?@ u͋ޡA@ A@ tEPPVWY uFN?@;bu밐?@EGGD?@+EEPVu #u?@EGGD?@+EEuuVui u;WV +uᐐF~=F8FtG*ލEPPVWX u @uՐWV= ;P($ L4  4 8| UVuFF?@>u NA@^Ð+?@A@^ÐUSWVu} ]FG8Ft3^_[ËK u^_[ÐUjU SWVjj +@jj+@jj+@h j +@jjrthP(j^E 0F~uE N90w>/uE N5@A@ t5@P? u?@E 8ru?@h @_A@ t:Cpt8qtWst"xtej0h @j jUeh@\j5A@h@ ?@;jjj@ +@ +@t+@h @h @u u >@7 @)EE =t+@tY5@+Ph-@8|+@@u"5@)t+@|+@=|+@u +@}~aE 0V=|-h @r)=|+@t h-@:jd2@ u-@, @;@ ?@?@h0 @h3 @_-@j?@=+@th8j=+@thjhX+@^ ^_[ÐUSWV?@=?@t ?@@?@?@?@=?@t&=-@uh@Ph@j ?@?@,u!?@?@l?@?@f;u@?@ۉ=*@?@?@+ u h"5?@Y;u ,5@?@,t=?@u ?@?@ǃeR G1 i!=_CEtQd w & =?@u45?@hp!Pq?@PW8@e;@ =@t=8@t8@jW ?@h?@?@o7 W =(+@ }12@ =?@t?@?@j =?@t?@*A@l?@9?@E=?@u ru05?@h"w  ?@E8@W=?@u0=-@@Pj=?@u 0 j 8@jSjW=@t@8@j= l?@9?@t$?@9?@v l?@9?@v j W=@t!jh3@&+@E!h4+@5@nh+@h3@ }Shh3@+@ } j h+@5+@ ,+@5+@j \fT+@2@E3@h3@SEf=+@=f+@f%f=)jh3@PD } j n EE u('@+@Ph4@+@ +@P+@Ph4@!S +@Ph4@ 3h3@ h3@h4@T t j h4@@}u (8@E?@9?@t;?@l?@9?@uu3vEhh3@+@ } j?[ v}u'8@E?@9?@t ;?@u l?@9?@t8@}E_+@ +@Xt+@5@!Ph-@.|+@@u(t+@|+@+@j@a=|+@f+@W_?@+?@%A@j a [=?@t?@?@VHXPtQXa c1d8ZfwP.$,h|Htt%0`hxuj<j j Z^_[ÐUSWV3EEkE ǃ0E @u=*@ u?@ }]E3@uE u tEǃ+t'- t̃ tǃ$'5F u@?@룐NWh;@h9@j@?@/u9l?@s?@9?@vl?@Sj u9@?@uj 볋l?@}$j@?@@u j?@9l?@r$93@u렐9?@w9l?@s jV^_[Ã-.t/?^=*@ u3^_[ÐU=?@u@?@?@?@?@9?@v jU=?@u)?@?@l?@?@?@9l?@u?@U=?@t jU?@9?@v l?@9?@v jdÐUVpt ltnu#?@lux?@nuh?@j t j^ÐUSWVEA@5؃ tu=2@>u}ft j}fuj 5-@!=@t h4@ =|+@t h-@ =x+@t h-@=@t 3PIÐU/=?@u5?@5?@ÐU SWVu} l?@+$)l?@;vu95l?@s5l?@5@?@8@^_[U SWVl?@5?@u ;r^_[Ðt 5@?@ ;vFl?@9@?@v@?@8@^_[ÐU SWV6@ju2@e"KujEu2@ u۸6@^_[ÐUSWV8@6@-@EjPt2@eG tF~ u1N=A@-@-6@%-@^_[ÐKujEu2@랐USWVu}|2@ jg+ǣ2@95@uE  2@-@^_[Ð95@u /@^_[Ã} = 2@tG=x+@t&h-@hh-@j@u j?hh-@5@  2@5@hEh-@V =x+@Sh-@hh-@j@3j?s$=@|=x+@t^/@E+@E EE CEM uh-@hh+@j)@u j?hh+@ hh/@5@ 5@UjE P5@% hu 5@U =t?@9l?@t j ÐU5@;-@E4@EE}4@r6@4@@@ 2@?@j3DfEhh5-@w @EPD=t+@t3x+@h-@i tx+@5@M 5?@:?@?@?@l?@?@@?@3 @@?@@t?@ÐU SWV=-@t j!0Lj u jXWh;@h9@j=u j\u t\FLjFE;w j" u;upF FF?@)#9?@w9?@rSjQ;Eu 9l?@sπdu uu '^_[Ð?@;t3#@?@-@?@?@?@9l?@s^_[U SWV?@9?@?@?@9?@r-3 G tF=A@rjᐐ6@?@ u+ ?@?@9?@sP?@P?@@?@^_[ÐUSWVEEA@"A@=?@z6@'=4@t(E4@E9u 6@E}4@r6@Wh`358@?@9=?@rcWjc tA@A@MW=A@t?@8tjj# 0=A@/듐}u#}u j# =A@u j#^_[ÐUSWV. t u j$Vh;@h9@jb;@\u"C?@r j&t ug=?@u?@j$e=-@t -@8u;=*@?@C=;@%uV=;@uM=@u0j7T;tыLjC?@Qj&Bh!@h;@h;@h!@@3 *@gu*@*@@t*|%0*@E@u*@ ^_[ËEk 0~jD뽐UWV6@=A@ u ^_ÊGF uA@3^_ÐUSWV=A@~#=A@}A@A@9A@A@A@6@?@;@95?@wr}&u5?@5?@W O}\u2CCE1|%p?@19E}EE>@T>@뻐EA@r j1CCE u5?@-?@6@?@A@r j u6@?@GF u^_[ÐUSWVu} ]GFA@r j;r^_[ÐU SWV~ u j'w=?@u}t=l?@Wh063l?@!?@=?@ g;v=?@;s8+ƣ@?@;t^WV_SWUSVK4;r$ƃ@?@SW/VS%VWΐj'8@^_[ÐUWVu} EE;w^_U졔?@9?@vÐ?@?@03ÐU9@p?@uÐUSWV2LJ?@LJD?@À |߃}t!=?@t3^_[Ð5?@5?@%?@9E tދE 0?@h9@V^_[ÐUVA@ A@A@ tF0P^ÐUVu=+@=x?@h+@EPh4@V E@u++@Ph4@j' j qjh @ uh4@j j K}u?j h @j ^Ð-@FFP>uj ^U WV5 @}=x?@t@-@=-@H|-@\F F u> uO<-FFLjF t2@r| @1@-1@fEEPh1@j ^_Ð@Wu t\F%0F%0F$0F-@y5 @^_ÐU$Vjj?EEPhTj EE܀eEPhTj u2Puj[ %@} t%@sEFSE@ujh @j fEfEEPhTj$ uj%@^ÐUSWV=-@t j! u j Wh;@h9@j?@,#9?@w9?@rSj%;Eu 9l?@sE?@&tWLjF-\u> t\FLjFE;w j" u FFE t j6-@}t?@?@ j8i-@?@9l?@r[t#@?@3Pq@u j4at itcu j5 떐^_[ÐU=?@t=@t@j=@u u4E =;@hh4@P" E=+@u(Ph4@ t +@ +@=+@~$h-@uh4@j9 @u j?jh+@h4@ }+@;@jjju> ;@EÍEPo/ } j1E 5+@jT5 +@jD5+@j 4jj(} tEEP} P} tEEPG,} tEEPjuh @h @h @',jU4} } tEEP} tEÐEÐUue=@t@j3ÐU SWV4@߾3@F>uN>/t3@ F~/uߊ uj/5-@85-@~5-@=-@GCG u^_[ÐUh+@h3@ }?@Ð,+@?@U=?@t =,+@t?@9,+@t j:ÐUh+@h3@N,+@?@ÐUVu F~/u=?@tEj3>u N>/u9ur^ÐUSWV}u u 34@E3@e t ^_[Ð3@x:uAu EPhTV ufEf%f=uE @3@3@3@  Ãdt tσ:tN<e t |E ψH룐 tu 돐 tc| t3@x>t 4@4@^_[ÐeKmtsttt /^_[ÐUV33@k 03@3@@u 3@^U3@3@8-u1@@tuPFÐuhÐ3@@t uݐ4@ 3@ÐUWV3E uΈ 8G|E 8^_U3@3@E3@@@t3@3@EEEuEP4@ÐU SWV 3@3ۋ;~|4@^_[ÐECψ3@3@8,tE 3@^_[U SWVuN}4@T> tR}J> u2;G?u?u 4@E D C;E CHF>uE E>t> tE D ^_[ÐE LExt @K;rء4@^_[ÐUSVEȋЋ2ۈ^ZYEX^[ÐU SWVuN} .> t.}&> u;G?uC;~CF>ù>t> uE xt@K;s ^_[Ð3^_[ÐUE E$@E8t!uEP9 tu uE 8t3ËEE8u뾐ÐUEE }tE EEEM :tEM}uE 8uÀ}t EE8uEM3ÐUE E ME  uÐUV@?@?@l?@?@Eu4@2@E}~?@EEȋ HEl?@9Ev?@^ÐUV@?@E?@@?@E?@l?@E?@l?@E?@?@EEl?@;?@w?@;ErEEEȋIEMHE}~^Ëu4@E2@4@E2@E}~^UuU@uju h'@] ='@uu3Ðh'@u@tÐUE8uxt uDEPEPh @ E u ÐEMI EMI HE@M &@EM &@EM %@E@M %@jEPEp EtutÐUjj Eju E0X t u\uj ҹÐuj 轹UEEEEjj 蘹EjEPE0 tuuj euu E0费 E;Eruu Ep E;Eruj 3UWVE'@EE3EME 0F|##ljE3EU00F|u@u ^_Ðuu}@t3^_ÐUE8uxuÐE&@EE@M9 &@u tj QѷE@4%@E4%@:E3҉QÐUVEP" |EP" }3^{$ uj跶jju輶 u蝶u蒶j舶jju荶 unjuh @h @h @#j'_E4'@E4'@u uh @um!M h @uX!M^ÐUWVE@ 4'@E @ 94'@t ^_Ðu践u 謵jj萶Ejj聶EjjrEEP&;tuuEuj?uj2uj%E^_U SV=$ @{ @9E ^[ËE @+tP-uE( @E(@A@-E @4u4E @48Fu! @딐E0 @E(@A@+볋E @4蘵A@P5(@j = @A@EE E 0KPE 0jr h< @.PhH @jU uPuj< hT @Ph\ @j jEPj ?^[Ð @3^[ËE @$ @A@:t;tP5(@~E "A@P5(@]E t5x:u/E @ @$ @A@$ @m= @A@EE E 0 PE 0j1 hd @Php @j uҳPuj h| @跳Ph @j޳ jEPjγ E @$ @$ @8 @$ @EE8:t 8;xE @$ @X tCE8;u-t+uA@/E @ @$ @@  @ @9EE8;uA@A@^[Ð= @CA@EE E 0蚲PE 0j h @}Ph @j褲 ubPuj苲 h @GPh @jn jEPj^ E8;E @-+E  @A@$ @ E @$ @$ @8$ @ @U8SWVuE} u3^_[ËE ;vGGtE}th @荰E t8th @P, u ^_[Ã} @EEDE}|EE%DE}@| @]EE\̃EEE]E}| @}]E @JEEE 9E}E<u%E | UWVj*ju 趯 3U}#E kME 8GE@u؋E8u3^_Ð t t5$EE8_u F}/3뼐Ex.t ^_ÐFܐEE8.t䐐^_UWV3%kE<8ujE PEPw F|^_ÐUjh@j u =Pu jf jh@jU E.$TSE @u Pu j j"h@j jh@j jh @Րjh@j֮ jh @jŮ j h@jh @j誮 jh@륐jh@낐jh(@sj h<@gRRRRS0Su E t1EPub tu j5EPuE8txt xhP@蕬E t0EPu tu jEPuE8txt xh @ t$E8uxu xu jEh @E EPui tu j<}t}t}t܋E8tEPu] tvExtEPEP- tFExtEPEP tEPuOE}jP}u u j]E8t xtxu EPh@TEPu3ÐU=@|5@1}t ju@ } Ð3Ujj5@菪 EuEhh(@5@觪 E ~3E(@EEE8 t EM}u}u2}(@u3Ðju5@ }tEEÐEE+E@EuuuZ tME@EwUVEPkEH @u , t3^hX@EPE-hf@EPjkEDPEPC E}|hh@EP©kEHP @EP謩jEPI|@u)}tkEH @j6Qj@^jEP| |kEHM8L @t(kEH @j||kEHD @E|ۧ}tkEH @j^kEH @jEPV) hl@kEH @P諨jEPkEH @P hn@kEH @P|jEPkEH @P HE @^ÐUWVEE)@} }3g)@^_Ðhp@h)@kH @Ph)@kHX @t!\ @P @Pʧ tEFkH @u}t @^_Ð3kHE9 @u  @^_ÐFkH @u3^_Ð}hu h)@h *@=)@/uEE)@E)@3juV E tF}u$}t*EEj/PE tEkH @uE ^_Ð3FkH @DkHM9 @uju VJ ^_ÐUV}|+EERkH @^Ðr@^U}uuj t3ÐUs@ÐUhD=hJu+u VE uE^_[Ã}})^_[À>Hu'uu V E t |u+}T>Iuuu VsҐ>#FOE>IuSuu VG E | m+EDEE؊ *@H}u E@?EDE2>uFOEDEE M@HE M@HFOE}}[>J>H]uu V E  +EDEE؊ *@HE؊ *@H랐EMEEMEE9EJÉE%x@Mԁ@E xf@ffffEEEEEf8@to}@}ifMf98@uf:@fEEE@M@EE럐E@M@EE9Ew E9EE>uFOF8^kO J}^_[ÐUSEEE Eà .$@fE@3[ÐE@搐E@֐E@ƐE@붐E@릐E@W떐E@놐E@sE@ c[Ðeeeeeeeff(f[U SWVEEE EEEEE@*@EE@*@}zEE%x@M(@LE x?}@3|1E@E%x@؋M@t ^_[ËE@E@E3FEf8@1@(8@;uEEf:@fEEE@*@E@FEf8@tU@}P8@;u݋Ef:@fEEE *@8@u *@8@uE3^_[Ð}t%EE *@8@u *@8@tÃ^_[ÐUSWVEEE Ev6ExHu-uu @P u3^_[ }$^_[ÐuE@E@*@EE%x@M4@tvE xtm}@EEEEf8@tB}@}<8@;uًEf:@fEE *@8 E@uE3E *@8 E@Ã^_[ÐL3Ð)4ÐUE PuÐUSWV3hH@ɖE uEP@j/ub t _@EPuV u PL@t ty Dž`@DžM  t!|L@^_[ÐPh@@ߐGwWP&C  tL@ 밐USWVu} ] >:t C>u9]t /GC?u>t F^_[Ð3^_[Ð/ÐÐ D3ÐUWVu D u3^_G EG G 3ɉOO h@at%rtwt*ÐO ~+ug O ^_jju O א*L$Q3ÐU}u3jEhTmjʔEEE}t7E9Ev )EE'E+EEEEEMuj|h*@ uuemjVE}| uj;} }}}tEEPEEUjh*@EÐÐÐD$Xpxh Z`P+␋T$D$;j t Zrzj bu@bD$Pt$Ð5@t$ t$  Ð;t3ÐUSWVEEh@LEhl@y t S-E}tuEE;EE;EEPk u 3^_[Ð}~jSVP t_}~juVP t>jh@VP t!jht@VP yh@VH} tVMDju V 5@Vh|@V =@A?Zt?tV8^_[U} t(u u͑uǑEHE8/uEÐV|$3O|$ L$Oϋt$ +D$^ÐUV@95d@v F u^Ð3^ÐUSWVu3u($Cw$ǹ +0E+uN>XtF>t aju3 u#>z~ju uEE^_[Ð!ÐUhPu0 =|hPu =}hPh@Ï hPh@誏 3ÐWVt$ |$;t1L$AIt)u*t!ItutItut Itu u3^_W+^_ø<,ÐL$tÐÐT$ڍÐUu1@u3Uu@u3ÐEÐU=@ uÐ@M `@@3ÐUV5@Ny^Ð`@Ny^Ð@@@@@@@$@@@\@p@|@@@@@@@@@(@8@T@l@@@@@@@ @(@<@T@t@@@@@@@@@@(@D@T@p@@@@@@@ @, @P @h @| @ @ @ @ @T @p @ @ @* @ @1@a $Ha2 (Hc 7c2 1c3 "&*.26:>Cf p !%)-159=s 7u ,write or open on pipe failedwarning: expecting `w'mark not lower casecannot open input filePWB spec problemnothing to undorestricted shellcannot create output filefilesystem out of space!cannot open filecannot linkRange endpoint too largeunknown commandsearch string not found-line out of rangebad numberbad rangeIllegal address countincomplete global expressionillegal suffixillegal or missing filenameno space after commandfork failed - try againmaximum of 256 characters in file names`\digit' out of rangeinterruptline too longillegal character in input filewrite errorout of memory for appendtemp file too bigI/O error on temp filemultiple globals not allowedglobal too longno matchillegal or missing delimiter-replacement string too longillegal move destination-no remembered search string'\( \)' imbalanceToo many `\(' smore than 2 numbers given'\}' expectedfirst number exceeds secondincomplete substitutenewline unexpected'[ ]' imbalanceregular expression overflowregular expression errorcommand expecteda, i, or c not allowed in Gend of line expectedno remembered replacement stringno remembered commandillegal redirectionpossible concurrent update-the x command has become X (upper case)Warning: 'w' may destroy input file (due to `illegal char' read earlier)Caution: 'q' may lose data in buffer; 'w' may destroy input fileEncryption of string failedEncryption facility not availableCannot encrypt temporary fileEnter key:SHELL/bin/rshHOME-sp:qxCusage: ed [- | -s] [-p string] [-x] [-C] [file] file name too longeearead may be incomplete - beware!ed.hup/ed.hup'\n' appendedline too long: lno = line too long: lno = -csh/bin/sh!too longtab count -csh/bin/shexec /bin/crypt -p 2>/dev/null-csh/bin/shwroptioncommands: illegal : illegal -- -- : illegal : illegal -- -- : : requires an argument -- requires an argument -- CHRCLASSasciiAOnR8@/etc/default/langLANG=@english_us.asciip`[(@0@english_us.ascii^4^<@D@english_us.ascii\\L@T@english_us.asciil[`[`@h@english_us.ascii[\t@@english_us.ascii<\x\@english_us.asciiLC_CTYPEctypeLC_NUMERICnumericLC_TIMEtimeLC_COLLATEcollateLC_MESSAGESmessagesLC_MONETARYcurrencylibc: setlocale: : LANG environment variable syntax errorunable to open no line in syntax error in cannot open locale filecorrupt locale fileunknown error CLANG/usr/lib/lang//_./      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~yn-$ +29AKT[dhlptx|%m/%d/%y%H:%M:%SAMPM%a %b %d %X %Z %YSundayMondayTuesdayWednesdayThursdayFridaySaturdaySunMonTueWedThuFriSatJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberJanFebMarAprMayJunJulAugSepOctNovDecalphaupperlowerdigitalnumspaceprintpunctgraph cntrl  @ @ @ @/bin/shPATH:/bin:/usr/binshTMPDIR/tmpXXXXXX/usr/tmp@AAA/  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ ((((( H J@J@d@ J@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL+ L27p@.textppL2p .data@@3@.bss@@7.fka000C".fka040@@LB.fka041L@L@.comment"G.libG@|@4@0@`O@8@@@hE@@pI@ @xM@$@@(@@@,@D@@ @@p@ÐET@RU RPWh@j_L@ P0jUSWV@9@| ^_[á@ @4>(t>)u~u ^_[Ð3G@;tVS u@^_[Ð^_[ÐUSWVu }h@V" t+h@W tV=W2+ WV؋E=t&=tK=t0= t5= t>= t? ؋ t7@^_[Ð 吐   ␃@ø@^_[ÐU Vh@u P th(@u< u h8@ u ZEuLEE= t= tC=tD=tI=t^EEju PVD^ËE)EҋEmEǐ}u hP@L E}ރ}u hd@0 E}U닐UVE=t=tp^Ðhv@u  thx@u  hz@u th|@uz u ~@^Ðu^h@u R th@u > u @^Ðh@u th@u  u @^Ðu ^U SWVu uE8tENu] E8tEO uE^_[ÐUSWVu3GF~ujW PSd^_[ÐU SWV3@GE <8t28M81uFV PjS^_[FE<0t3뷐@^_[ÐUVu uZPQ PjCV=D@t'h@@Ph@V^ÐUWVu jh@h@V=D@~ h@ h@u tR=D@u=5D@= E@+' } h@A WVh@ Ƈ@LE@+E^_3^_ÐUh@ ÐU4SWVu }EEEG_;]t u5 u OXE@>L=TE@?j)^_[ÍEЉE3DE@D@E\E@^u \E@O9uw j2[G_*t \u?{tu9]u F^_[Ðà t5$t|*tU.t[\u8 ]=TE@uOFXE@^_[Ðj$}tEE<t<tEB;Et? uE@EE[G_^uEE̋ˈG_]EE̋ˈ u j1A[EE̋ˈ}@r j2G_=t.t :]EE̋ˈ}@r j2G_ u j19]uˋEE̋ˈ}@r j2G_]uԋEE̋ˈ}@r j2G_]*E̋ˈE@j^E+PVEP ttFj21j$'G_à (tK)t~n{}@019] j$F$=D@ | j+EE܊ D@FD@D@E9EvDE@D@9DE@t j*bFM܋E܊FE}6EEG_E}@tkE Ã0E jG_\t,u΁}| j EF,u"EE t j,G_\u'FG}t j-}uEF*OYF8Fj.Ij$m X^_[ÐUSWVu} =\E@t5HE@WVc^_[Ð?u;_;u WVA t5HE@^_[ÐF~u3^_[ÐWV uF~uUSWVu} GG#w.$G8Gt3^_[ÐF~tҐ>uȐ5LE@^_[ÍEPPVW tu@GG4D@끐GG4 E@nGEW`E@ `E@ u*ޡdE@ dE@ t8Et=dE@}F8Et4Wv`E@ `E@ uޡdE@ dE@ tF~u믐F~uDP/&EPPVW u`E@ `E@ u͋ޡdE@ dE@ tEPPVW uFNPE@;bu밐D@EGG E@+EEPVu #uD@EGG E@+EEuuVui u;WV +uᐐF~=F8FtG*ލEPPVW u @uՐWV= ;P`  \ 8 l  L ( 8 l p UVuFF`E@>u NdE@^Ð+`E@dE@^ÐUSWVu} ]FG8Ft3^_[ËK u^_[ÐUjh@j uPuj jh@j j!ÐUSWV@3ۃ}} CmE}u @^_[ÐNE 0NEE}E u t-NF^_[ÐUE=}Ʌt h@}u$@@ @E@E.}(u%@@5@j}E @u E t1EPub tu j5EPuE8txt xhh @WE t0EPu tu jEPuE8txt xh@ t$E8uxu xu jEh@E EPui tu j<}t}t}t܋E8tEPu  tvExtEPEP tFExtEPEP tEPuOE}jP}u u j]E8t xtxu EPh@TEPu3ÐU=0@|50@}t ju0@ } Ð3Ujj50@ EuEhh@50@& E ~3E@EEE8 t EM}u}u2}@u3Ðju50@| }tEEÐEE+E@Euuu tME@EwUVEPkEH(@u , t3^hp @EPE-h~ @EPjkEDPEPc E}|h @EP}kEHh@EPgjEPE|@u)}tkEH(@j6Q @^jEP| |kEHM8d@t(kEH(@j||kEH\@E|}tkEH(@j^kEH,@jEPVI h @kEH,@PfjEPkEH,@P h @kEH,@P7jEPkEH,@P HE,@^ÐUWVEE@} }3g@^_Ðh @h@kH,@Ph@kHp@t!t@P,@Pz tEFkH(@u}t,@^_Ð3kHE9$@u ,@^_ÐFkH(@u3^_Ð}hu h@ @=@/uEE@E@3juV E tF}u$}t*EEj/PE tEkH(@uE ^_Ð3FkH(@DkHM9$@uju VJ ^_ÐUV}|+EERkH@^Ð @^U}uuj t3ÐU츋 @ÐUjju uUjuu uÐUSEEEEEEM8E 8EPEPEP* EEPEPE P EE @EE @E:t E+[Ð}uEE @M M @+E}iM`3[ÐEM8u3EPEPEP EE M8u3EPEPE Pc E9Et E+E[Ð}tE[UhD=hJu+u VE uE^_[Ã}})^_[À>Hu'uu V E t |u+}T>Iuuu VsҐ>#FOE>IuSuu VG E | m+EDEE؊ @H}u E@?EDE2>uFOEDEE M @HE M @HFOE}}[>J>H]uu V E  +EDEE؊ @HE؊ @H랐EMEEMEE9EJÉE% @Mԁ(@E xf@ffffEEEEEfP @to}@}ifMf9P @ufR @fEEE @M @EE럐E @M @EE9Ew E9EE>uFOF8^kO J}^_[ÐUSEEE Eà .$+E}@3[ÐE}@搐E}@֐E}@ƐE}@붐E}@릐E}@W떐E}@놐E}@sE}@ c[<+T+d+t+++++++[U SWVEEE EEEEE @@EE @@}zEE% @M@@LE x?}@3|1E@E% @؋M4@t ^_[ËE@E@E3FEfP @1@(P @;uEEfR @fEEE @@E @FEfP @tU@}PP @;u݋EfR @fEEE @8 @u @8 @uE3^_[Ð}t%EE @8 @u @8 @tÃ^_[ÐUSWVEEE Ev6ExHu-uu @P u3^_[ }$^_[ÐuE@E @@EE% @ML@tvE xtm}@EEEEfP @tB}@}<P @;uًEfR @fEE @8 E @uE3E @8 E @Ã^_[ÐUSVE 8tEE^[ÐE0% @΁X@t0E EM  M @EE @^[ÐE0% @؋΁d@tuEE^[Ð tEEÀu=t3^_ÐV|$3O|$ L$Oϋt$ +D$^ÐUhPug =|hPuI =}hPh|@+ hPhx@ 3ÐÐWVt$ |$;t1L$AIt)u*t!ItutItut Itu u3^_W+^_øÐV|$3O|$ ыt$ D$^ø<ÐW|$D$ L$~% ‹ʁD$_ÐT$ÐUu1@u3Uu@u3ÐEÐU=@ uÐ@M <@@3ÐUV5@Ny^Ð<@Ny^Ð@@@@@@@@@@@@@@@@@@@@      |&+-*/%:===<<=>>=!=matchsubstrlengthindex-\{0,1\}[0-9]*$-\{0,1\}[0-9]*$10-\{0,1\}[0-9]*$-\{0,1\}[0-9]*$non-numeric argumentdivision by zerodivision by zero00000000Too many '\('sparen problemRE errorexpr: -2147483648syntax errorsyntax errorsyntax error 0/etc/default/langLANG=4@english_us.ascii1@@H@english_us.ascii##T@\@english_us.ascii@""d@l@english_us.ascii!x@@english_us.ascii!!@@english_us.ascii!$"@english_us.asciiLC_CTYPEctypeLC_NUMERICnumericLC_TIMEtimeLC_COLLATEcollateLC_MESSAGESmessagesLC_MONETARYcurrencylibc: setlocale: : LANG environment variable syntax errorunable to open no line in syntax error in cannot open locale filecorrupt locale fileunknown error CLANG/usr/lib/lang//_./      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~yn-$ +29AKT[dhlptx|%m/%d/%y%H:%M:%SAMPM%a %b %d %X %Z %YSundayMondayTuesdayWednesdayThursdayFridaySaturdaySunMonTueWedThuFriSatJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberJanFebMarAprMayJunJulAugSepOctNovDecalphaupperlowerdigitalnumspaceprintpunctgraph cntrl  @ @ @ @ @ @  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ ((((( H M@M@@@M@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL+ tpd@.textppp .datad@d@d@.bss@@.fka000C".fka040@@LB.fka041L@L@.comment".libÐETe@RU RPhd@j L@ PjU SWV@%;uhPj F^[:l@u͋+PPj jhl@j =@u jQjG^_[ÐUjEPj t@l@ÐEÐÐT$>ÐÐUu1@u3Uu@u3ÐEÐU=@ uÐ@M p@@3ÐUV5@Ny^Ðp@Ny^Ð @(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL+ < p@.textpp<p .data@@@.bssL@L@ .fka000C".fka040@@LB.fka041L@L@.comment"L.libn@ @@L@@T!@ @\%@$@@(@@,@@@ @@@4@0@D'@8@@ÐET@RU RPWh@j[L@] PjUh0@h@;EEEPu h0@1 h0@h@}| @9E|uh@h0@ uE4X@h@h0@ 0@yh0@j 4@Ð 4@4@@U}tXh0@h@qE EE Puh0@g 0@yh0@j  4@4@h0@h@jgÐUEEEfE?tetSmtptAjB0EP5H@ t5H@h @jEEh@u u E@u@@9E j}u`PP!BE @@@@EP}tuu%uu@@9E=@@P4ÐUVEu>8t!>9tE0EF @uڀ>t ^ÐE M3^ÐU SWV];/u{/uC>/tF>u>t FG?/t;tڊGF uΐ9us N>/u^_[ÐUu u u3áL@Euh4@P EÐUVuF>/t-juC tu uE u#/Fj/V uu ug^Ð(%Ð/ÐÐPÐ.3ÐÐt3Ð<\ÐUVE@ u @ t H uuu ( E@ t ^Ð^Ð T$ÐUu1@u3Uu@u3ÐEÐU=H@ uÐH@M @H@3ÐUV5H@Ny^Ð@Ny^Ðmkdir: ; System error %d%s (error %d)mkdir: Usage: mkdir [-pe] [-m mode] dirname ... pem:Invalid mode: %sCannot make directory "%s"Error @ @ @ @ @ @ @8 @L @` @p @ @ @ @ @ @ @ @ @ @ @0 @@ @T @h @| @ @ @ @ @ @ @ @ @$ @8 @T @h @ @ @ @ @ @ @@(@L@h@t@@@@@@@@ @$@<@H@T@h@|@@@@@@@@(@D@T@`@l@@@@@@@@@ @H@p@@@@@ @8@T@t@@@@@@@@@`@@@@@@@8@T@`@|@@@@@@@,@D@P@\@h@t@@@@@@@@@@@@@ @,@<@L@\@p@|@@@@@@@@@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in path ((((( H l%@l%@@t%@@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL1+ $  p @.textpp$ p .data @ @ @.bssH#@H#@ .fka000C".fka040@@LB.fka041L@L@.comment"H#.libj#@@4@0@X-@8@ @@`#@@h'@ @p+@$@ @(@!@,@!@@ @@@ÐET @RU RPWh @j'L@ P jUEHE?t8ftitrt.\#@T#@X#@Eh @u u E@u}~}th @h,@j@@)EE =h @E 0 uh @h,@yE 0.E EM =P#@t3PÐU EPu@u(=\#@ uh @h,@ fEf%f=@uEPEPu Ð=T#@tuh @Wr u`Ã=\#@uUfEf%f=tGju.@u7@P t#E%Puh @  tHut@u:=\#@t =T#@t(uh @h,@ h @P#@U V=X#@u uh @h,@ P#@^Ð=T#@t3EPE P uuh4 @E` SutE uhH @h,@r h\ @sjh^ @E P: fh` @E P JuP{E u)hd @h,@h~ @j"E Puƃ=|AhE Pu@Ph @h,@yjE Puh @u6jM;TQuuE u9uh @h,@ h @j9 uuuvE hupEPE P uV=T#@tuh @"= t4u t%P#@h @h,@Wh @X^ÐU @yh @@@EE7}t5}t/ @yh @j@@E} uŃ}yÐU0fEEh @uh@uvEE9E}}uh@unݐEPu@u"uh@h,@J h4@KfEf9EufE f9EuÐfEf9Eu3ÐfEfEuEkEPaE u)h @h,@h@jh@uEUH#@|ÐU=H#@uyL@Ehj 8L#@u uE=H#@|tH#@$ tL@E5L#@j EL@=H#@|tEÐu uH#@ÐUVL@=L@|@9L@} L@4T@}tE8tPh8@h,@ 5L@VL@u @@H@Ph,@z^Ð[ÐOÐÐUVuv KVB6^U(WVju } 3^_ÐEPWn |2fEf%f=@u$jG th4F u%fEf%f=@t L@Wg두>3FF^_ø3ÐÐUWVuE~t~~ FEGFF9F|3FF~u+hv 6( F  uEF3^_Ð~~ ^_øQ@Ð?,Ð%T$ ÐUu1@u3Uu@u3ÐEÐU=D#@ uÐD#@M "@D#@3ÐUV5D#@Ny^Ð"@Ny^Ðfriusage: rm [-fir] file ... ..rm: cannot remove .. rm: %s non-existent %s: ? %s: %o mode ? rm: %s not removed. rm: %s directory directory %s: ? rm: cannot open %s ...rm: Insufficient memory. rm: Path too long (%d/%d). %s/%srm: cannot open %s %s: ? rm: Unable to remove directory rm: Insufficient memory. .....%s/%.2srm: Unable to stat file %s %s: %s %d %s Error@@@@@ @@4@H@\@l@@@@@@@@@ @@,@<@P@d@x@@@@@@@@@ @4@P@d@@@@@@@@$@H@d@p@|@@@@@@@@ @8@D@P@d@x@@@@@@@@$@@@P@\@h@|@@@@@@@@@D@l@@@@@@4@P@p@@@@@@@<@\@@@@@@@4@P@\@x@@@@@@@(@@@L@X@d@p@|@@@@@@@@@@@@@(@8@H@X@l@x@@@@@@@@@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in path ((((( H +@+@!@+@@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sLY+ |Jp @.textpp|Jp .data @ @K@.bss!@!@.fka000C".fka040@@LB.fka041L@L@.comment"a.liba@|@@@@@ @@$@@(@@ @,@D @@ @@p@4@0@@8@ @ÐET @RU RPWh @j5L@ PHjU@E=@E @=@@@P@@ @<@,J@$@$@4J@L@@ >@@D@@$>@=@>@S@ @@@@@@@@T@X@=@@(J@==@upjd@@8-uf@@eefgon@@Ph @h@ jG =@==@=,J@$@u/-@=@(>@K@ =@(>@=@th @h@j*G @ ,J@H==@jP@W=@ =@  jFh @@@0=@ u#@0h @h@ jFo5=@(>@Q(>@,>@@@0 =@yh@_jFU(SWV=>@h@@w  =@@#u(=A@nu P@h@@F [ 0J@@@0J@E< t< u 0J@搐0J@8t8;t,J@0A95=@u!h@@h @h@ jVE,J@90u2 t 8h @h@j#E u,J@0,J@80J@E<,t<;0J@,J@p;5>@v!h@@h @h@ jD,J@p_95=@t u!h@@h @h@ jpD,J@9pux,J@x,J@@95>@s!h@@h @h@ jD0J@E< t< U 0J@␡,J@@,J@ȀyوH@@ ,J@ @,J@ $>@9,J@r!h@@h, @h@ jC,J@00J@8,J@8t!h@@h< @h@ jLC @yhD @h@j(C@@ ,J@,J@0-,J@@ ,J@x h@@hX @h@6 jB ,J@8t!h@@h< @h@ jB0J@0J@8 t 0J@<@0<@;w!h@@h( @h@ jNB0J@0J@C uK5<@ E txtUh@@hT @2<@@ <@E<@@9<@r!h@@hl @h@. jAE ,J@H,J@@,J@xt!h@@hX @h@ j~A0J@8\u0J@0J@0J@8 t!h@@h @h@ j=A,J@p,J@pE +,J@@뒐,J@@W,J@@,J@@,J@@,J@@,J@@ ,J@@0J@0J@8 t 0J@0J@8uK @@ E t(EEE@E uE ,J@ @ ,J@H M<@-<@;w!h@@h( @h@r j @0J@0J@C u 0J@K5<@6 E t0J@0J@8 o,J@@,J@@,J@@$@,J@@ ,J@@,J@@0J@0J@>@,J@p>@P5>@,J@pj!95=@u!h@@h @h@} j>,J@9pux ,J@x,J@p ,J@p ;5=@u!h@@h @h@ j=0J@8gu 0J@ =,>@t ,J@@0J@EE}@t:E؃0E tE0J@0J@E}@,J@MH0J@8pu0J@,J@@0J@8Pu0J@,J@@0J@8w 0J@0J@0J@8 t!h@@h @h@. j<=(J@ |h @h@ j<i(J@4>@P(J@HEFkE E0E=h@@hx @h@ jB<M}|CiE4>@Pi(J@4>@P uΡ,J@M =@Hh @i(J@4>@P+ ,J@A u,i(J@4>@Ph @h@ j;(J@(J@ ,J@I =@,J@@ 0J@0J@8 t!h@@h @h@ j=;=(J@ |h @h@j;i(J@4>@P (J@HEM}|/iE4>@Pi(J@4>@P uh @i(J@4>@P ,J@A i(J@4>@Ph @,J@@r,J@@0J@0J@>@,J@p,J@p@95=@/h@@h @.NPaEb@9,J@r!h@@h@h@& j8,J@00J@0J@80J@x;h@@h @h@ js8,J@@=>@^_[U WVu=0J@95>@s!h@@h @h@ j8G<\u]F95>@s!h@@h @h@R j7G}@t0E;H@~ =@^_Fs>@8uF=0J@^_ÐF~JƐU SWVuN=(>@=(>@~u(>@=@ =@  jE7@@8FG tN<\uFG u!@^_[À> u=!@^_[Ë=!@ tFG u !@ր>\uFG<0u룐> u벐=@H@@tFÈ<\uH=@y5=@`=@H@F=@y5=@1몀> uIUSV0J@8$u"0J@EEEEE^[Ð0J@/t\uC0J@8\u0J@0J@0J@>@>@P5>@uj)^[Ð50J@EkE 0EF}@u950J@shEEEE 0>@0>@0>@M T@=0>@|h @h@j35EE50J@3^[ÐUWVuN} O>u3^_ÐFG8t^_ÐUWVu=0J@G<\uG>uO=0J@F^_ÐFڐU @Euuy uEÐEE9Er3U @E,EMIHEE@E uEMIHE<@9Es6ExuPh8@h@o j4Ex tË@ 륐ÐUSWV};>@v!h@@h @h@ j30J@EC>@8t;\uC; t;u=@^_[CEE0>@;u>@8uC0J@EP\uE8nuE C7<\u ;nu7 C>@87t<7u닐E<uM E}|升^_[ÐU4SWVu =0J@EEEGG;]t u0 u Ox@>uk=@ub=0J@=@^_[ÐEЉE3h@H@E|@^u |@O9uvGG؃*t \u?{tu9]uF=0J@^_[Ðà t5$tt*tK.t[t}\uF =@EOFx@떐}t‹EE<t<tEL;Et? uE!@EE[GG؃^uEE̋ˈGG؃]EE̋ˈ [u~EE̋ˈ}"@GG؃=t .t:uo]EE̋ˈ}"@ZGG K9]uՋEE̋ˈ}"@/GG؃]u؋EE̋ˈ}"@ GG؃]NE̋ˈE!@j^E+PVEP" FGG؃ (tC)tnne{}@019]t$=H@ ]EE܊ H@FH@H@E9E.h@H@9h@FM܋E܊FE;}EEGGE}@kE Ã0EGG؃\t,uց}EF,uEE GG؃\uFG}tmO}}uEFF8FBx USWVu} =|@t5l@WVc^_[Ð?u;_;u WVA t5l@^_[ÐF~u3^_[ÐWV uF~uUSWVu} GG#w.$G8Gt3^_[ÐF~tҐ>uȐ5p@^_[ÍEPPVW# tu@GG4 @끐GG4D@nGEW@ @ u*ޡ@ @ t8Et=@}F8Et4Wv@ @ uޡ@ @ tF~u믐F~uDP/&EPPVW" u졀@ @ u͋ޡ@ @ tEPPVW" uFNt@;bu밐 @EGGD@+EEPVu #u @EGGD@+EEuuVui u;WV +uᐐF~=F8FtG*ލEPPVW! u @uՐWV= ;PplH|($\08H|(UVuFF@>u N@^Ð+@@^ÐUSWVu} ]FG8Ft3^_[ËK u^_[ÐUSWV}t-ju?@ }!uhT@h@ @@@@@=@@@SK=@=P@=@@@4E@$@{tƋ3{ {tj?u 3?uCGE @9 T@}C{f 뫐E @9 T@umCgjWH tX鐐>u=@uE{t>uFE @9 T@ujV t tC{k=@\@[ $@ @@F95@v @yh@PL @yh@j 3 @@=P@@v @h@@ E;=@I5@^_[ÐUV} tE8t3^Ð5p@5t@@@t@EE|@uV^UjEp u3Ð@ @Epp FExtp@8tjEpG u @ÐEpp ǐUSWV} ~} }@@9E  @@@T@]95l@wn}&u5p@5l@W K}\u&CCE1|:}E@\@ƊE@rhd@h@CCE u5p@-T@@@p@@rh|@h@g u@@T@GF uF@^_[ÐU SWVu} ] GF@rh@h@ ;r܋^_[ÐUSWVE@.$D-P@P@M=P@P@r5@h@h@ P@@Ext =@Ex1 @yh@GGPG @@?u @Hh@j ^_[Ð@@? u GGC uC@@Gu@5@h@h@ @@X@C uG@^_[Ð@@ =@X@C uϐX@@@C uGT@^_[ÐT@T@ =T@@@C uϐEx1 @yh@GGPG @@?u @ @@@@T@@? O?uFE@(9D@w\hT@h@h@w T@EEC uK}@W\C9D@w\hT@h@h@' T@ff%0C9D@w\hT@h@h@ T@ff%0C9D@w\hT@h@h@ T@$CG9D@\hT@h@h@ T@hGC9D@wZ\hT@h@ϐL@E(9D@w\hT@h@h@' T@EEC uKG?WhT@h@0=P@ug@@ @@G9=@v @yh@P@ @yh@j ' @@=P@@vh@@E;=@uE@@^_[ËE=P@@vw@@ 5@2E;=@td@@ @@G9=@ @yh@PLؿ@@:?y @yh@GGPG @@? u?=P@ug@@ @@G9=@v @yh@P @yh@j  @@=P@@v;h@j{P@P@M=P@P@5@h@uExt~=P@tu tqx@@ @@G9=@v @yh@P @yh@j  @@  Exh@@h@Ep&= @ @@^_[Ð@@T@GC uX@@@GC uC@T@X@GC uC@@EX tqG%&&p''++*(+)&,---,,\**-&(-&','L',^_[ÐU SWVu=@9=@w8hh@5@^  =@^_[Ð@ǣ@G_ ul9=@wMhh@5@ !5@==@u @@ǣ@@=@^_[Ð B95L@6ÈF,UWVu EPuFPuF;u ^_Ð|@^_ÐUWVP@@P@8uow1 @yh@FFP @@>u @yh@j  @@h@P@pE tiEyuoEH@E@t6EE @yh@EPH붊E @@룐uwP@P@8P@@@^_UWVj*ju 3U}#E kME 8GE}@u؋E8u3^_Ð t t5$EE8_u F}/3뼐Ex.t ^_ÐFܐEE8.t䐐^_UWV3%kE<8ujE PEP F|^_ÐUjh@j u iPu j jh@j E.$(2E @u Pu jG j"h@j6 jh @j jh @Րjh@j jh4@j j h @jh4@j jh,@륐jh@@낐jhX@sj hl@go1h1111222jhz@jvU4h|@uM uE4@uu t ÐE8txt x>u E t1EPub tu j5EPuE8txt xh@CE t0EPu tu jEPuE8txt xh @ t$E8uxu xu jEh4@E EPui tu j<}t}t}t܋E8tEPu tvExtEPEP tFExtEPEPV tEPuOE}jP}u u j]E8t xtxu EPh4@TEPu3ÐU=H@|5H@]}t juH@ } Ð3Ujj5H@ Eu>Ehh"@5H@ E ~3E"@EEE8 t EM}u}u2}"@u3Ðju5H@@ }tEEÐEE+E@Euuu tME@EwUVEPkEH@@u , t3^h@EPE-h@EPrjkEDPEPO E}|h@EPAkEH@EP+jEPu|@u)}tkEH@@j6Q@^jEP|H |kEHM8|@t(kEH@@j|1|kEHt@E|}tkEH@@j^kEHD@jEPV5 h@kEHD@P*jEPkEHD@P h@kEHD@PjEPkEHD@P HED@^ÐUWVEE#@} }3g#@^_Ðh@h#@ykHD@Ph#@ckH@t!@PD@P# tEFkH@@u}tD@^_Ð3kHE9<@u D@^_ÐFkH@@u3^_Ð}hu h#@ $@=#@/uEE#@E#@3juV E tF}u$}t*EEj/PE tEkH@@uE ^_Ð3FkH@@DkHM9<@uju VJ ^_ÐUV}|+EERkH0@^Ð@^U}uuj t3ÐU츣@ÐUhD=hJu+u VE uE^_[Ã}})^_[À>Hu'uu V E t |u+}T>Iuuu VsҐ>#FOE>IuSuu VG E | m+EDEE؊ $@H}u E@?EDE2>uFOEDEE M@HE M@HFOE}}[>J>H]uu V E  +EDEE؊ $@HE؊ $@H랐EMEEMEE9EJÉE%@Mԁ@@E xf@ffffEEEEEfh@to}@}ifMf9h@ufj@fEEE@M@EE럐E@M@EE9Ew E9EE>uFOF8^kO J}^_[ÐUSEEE Eà .$EE}@3[ÐE}@搐E}@֐E}@ƐE}@붐E}@릐E}@W떐E}@놐E}@sE}@ c[dD|DDDDDDDDD[U SWVEEE EEEEE@$@EE@$@}zEE%@MX@LE x?}@3|1E@E%@؋ML@t ^_[ËE@E@E3FEfh@1@(h@;uEEfj@fEEE@$@E@FEfh@tU@}Ph@;u݋Efj@fEEE $@8@u $@8@uE3^_[Ð}t%EE $@8@u $@8@tÃ^_[ÐUSWVEEE Ev6ExHu-uu @P u3^_[ }$^_[ÐuE@E@$@EE%@Md@tvE xtm}@EEEEfh@tB}@}<h@;uًEfj@fEE $@8 E@uE3E $@8 E@Ã^_[ÐVt$T$ :t#t:tt:tt :tu3^ËH^ÐWVt$ |$;t@uAt8u9t0u1t(u)t u!tututu u3^_W+^_ÐWV|$L$3ыϋt$+΋|$ ȁ3D$ ^_ÐUSWVu @ u 3^_[Ð;tsV t^_[ÐUWVu} G8Gu F~=u^_À>u=t3^_ÐV|$3O|$ L$Oϋt$ +D$^ÐUhPu( =|hPu =}hPh|@軶 hPhx@袶 3ÐWVt$ |$;t1L$AIt)u*t!ItutItut Itu u3^_W+^_ËV|$3O|$ ыt$ D$^W֋|$ 3ыt$ |$ȁD$_ÐʹT$ÐUu1@u3Uu@u3ÐEÐU=!@ uÐ!@M \13\14\15\16\17\20\21\22\23\24\25\26\27\30\31\32\33\34\35\36\37Can't open %s output line too long. Output line too long. Output line too long. Too many appends after line %ld %ld %s %s %s %s %s %s %s %s Too many reads after line%ld %s r/etc/default/langLANG=L@english_us.asciiJ4:X@`@english_us.ascii<=l@t@english_us.asciih;;|@@english_us.ascii@:4:@@english_us.ascii::@@english_us.ascii;L;@english_us.asciiLC_CTYPEctypeLC_NUMERICnumericLC_TIMEtimeLC_COLLATEcollateLC_MESSAGESmessagesLC_MONETARYcurrencylibc: setlocale: : LANG environment variable syntax errorunable to open no line in syntax error in cannot open locale filecorrupt locale fileunknown error CLANG/usr/lib/lang//_./      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~yn-$ +29AKT[dhlptx|%m/%d/%y%H:%M:%SAMPM%a %b %d %X %Z %YSundayMondayTuesdayWednesdayThursdayFridaySaturdaySunMonTueWedThuFriSatJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberJanFebMarAprMayJunJulAugSepOctNovDecalphaupperlowerdigitalnumspaceprintpunctgraph cntrl  @ @ @ @  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ ((((( H @@@ @@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL+ hl!8"p @.textpphp .data @ @l!ح@.bssD/@D/@8".fka000C".fka040@@LB.fka041L@L@.comment"D.libf@)@4@0@|Q@8@ @@G@@K@ @O@$@*@(@-@,@-@@@@'@ÐET @RU RPWh @jkL@ PjUWV ED@j :h@:E t$p APh @ uE}~@E 0APh@ tE 0APh@ u3V")jj茩D/@ } D/@; D/@u uKPD@} D@8D@G?usfD@u PD@EE PD@+TD@ PD@hD@FTD@0hXD@1+PhD@s5h0@h@1h@h@15(@T< @h @5Eh(@P1f @f @f 5XD@!@8-uUh@h-@@ @ | Vh@h-@@ @ |V%D@߃}t u D@=D@t5D@( @GfD@t35XD@) @ @8t5XD@J D@j M^_ÐU,WVEE @8~8EP5D/@[ }z5D/@ @0| @ D/@[D@u:D@5@<  @0%  t.@,jh@p @0e^_Ð@Ph@/h@hD@n/ D@$j=@t5@5@E D@%D@h\D@m t f}f30D@$D@,D@LD@|D@ D@ @8 | W~&jHKK(D@tD@D@tU @xuJfxuC=H/@t%EPE+E; @| E؉E5@7 D@fxD@rO$D@ @fxu>%D@54D@jjj n PR @f D@ff H)^_UD@t @xu5P@&7ÐUP8D@h @hD@JHD@UWVu} |+WWWjV_ VBjjWI ^_ÐU4SWV5H/@@Eu3fE >:t>%u uF fE>u tEЀ8t[EPu |H}t7E t.9]t) tGP6j =6 h,@6EME8u t%f}t:FE>7^_[ÐU WVu5@EH/@ t8>:uGF>uP%@EEEO u^_ÐUSWV} }G8-~-uGME^_[Ð~ub%D@Y,@8tC;u8uvht@E 0H u4hx@PH th@E pF>u-,@<@ D@D@t4D@ː>cu}~=D@uGD@GM럐}G8+uxf,@8tC;uh@PG u;8u5-,@<@ED@EtE!D@>eu 4D@F>uGME8D@=D@t0,@$-,@ D@ <@t EE C;uڋEUUWVu3G~uWuL/@GPD@^_UWV=L/@ t)Ou$6M>uW<^_ÐUSWV3] t;KCE9L/@uu ^_[Ð^_[Ð}u6>uSU SWVE  P }FރTD@w,E M u^_[ÐU SWV3] t9;9L/@u C&6%>uS^_[ÐU=X/@tW Vj~jE@jh$MAjhMAD@ujh$uD@j3MA 7^_[Ðj؋C =LD@tD@P#D@C= uH|D@jC |D@=D@ t=D@;tX=D@ uUhj=D@u !(PCYj %؋=D@u P`jhCjh!{Cjh(djjj)CCSjɐEE=D@ ?0D@(D@E0D@X?<)tj <E܋=LD@tD@P+"M܉AE܋ D@HfD@LD@j@M܉A LD@D@9EEԋ@EԋM9Hu D@HD@D@EأD@j؋{CE=LD@t8D@EP2;PD@PEP:D@E=D@t}tMEEEMEED@% E;f}tsC=D@VEC E=|D@=LD@tfD@@{zCEE d<$\s ju G===+= 3^_[ÐU[fD@: tD@ÐU SWV5D@D@tJ=<t=>tu @멐<؀&u΀뒀>u 념À̀0D@rD@GG7t D@G= D@9uG ^_[U8 tÐUVu#5D@tE;D@t|^ÐUVfEt)@ E9Ft ~u6$^Ð}uhL@fEt u $} uh@u#^ÐU#hX@#D@ uhd@# @px$hD@{#j`#=D@t 5D@"D@Pr&j'l#hX@3#j U#jWÐU"u4&} thD@"u "j #jUjuÐUE(D@4D@ D@D@$p< t:j %3D@F@fF@jh\D@莍ÐUV5F@ t#F@jV]SVtj d35(D@P^ÐUD@9ErÐD@pD@pD@@D@D@9ErÐU=D@uÐD@p}D@@D@=D@uUH!u$} thD@a!u V!j x!D@t jq4D@ D@(D@tD@ÐUWVu u$5@qr@udh<@^_ÐufD@tAc^_Ðä@t.#u5`/@d/@3^ËEh/@E-E0u31@E tE EE@ E u̓}t}u E^ÐE`/@Ed/@덐UWVjyEu`/@ME d/@H E^_ÐUEEEEEEE8uEEÐU,SWVu}EEEfEWj/0 t ^_[ÐW fCt} tCC^_[Ð tVR E t ^_[ÐfCf%f=u:=t/@u!CEԡp/@9EvC%` Ep/@EfC`fC wfCC5@h@WU E tfEfEE* tVE LuWcE}~s u!EWEuuP f{u4E;p/@sfEfCfEfC/@C/@E Cx/@CE^_[ÐUE`UhH$/@U/@EHE@E u/@UxD@t=(D@t(D@PUEf@tmf@ue@PEf@t j*Pj FE@Prj ,E@PE0j Uh@Gh$UWVp/@'h@ t:>t5>/uG=p/@'u=p/@VP ϐt/@^_Ðt/@^_ÐUujE tf@u_f@5@h@u E tfEfEfEu&EEEuuP ÐUuE tf@tf@Uuj/(, t ÐuE tOf@t@ËEf@f%f=u%E|/@ E@EEM9HuIHuJjjuk ÐUWVuV'Vh t>fGfEfGf%`fEG%=t@=tE==t{5@h@VJ h@vh@kVEh@Vh@EpQh@"fGf%f=u7j     jVp fEfu h@fEfEfEf%`fEh@YEPVE= t=@t"=`t#h@"h@h@h@ސjVE ~fh@EPV>E%`= t=@t%=`t& h@j X^_Ðh@h@ڐh @^_ÐUSWVu]]x/@VX} 'p/@ WKuE ;p/@D@Ex/@W h@VW jhu E up/@ ^_[Ðh@VW jhu E up/@@^_[Ðh@VW jhuZ E up/@`^_[ÐjVWK jj@u( E u p/@^_[ËE ^_[Ëp/@ tJx/@D@EW h@VW jhu E u }Eh@VW jhu E u@뿐h@VW| jhuV E u`돐jVWO jj@u* E dE;EEEC^_[ÐU$VuEPV uEE%E} @u}t=t ^ÐE PV} u3^Ð=L@ u ^Ð^UWVuV tVWM ujVWb 5D@X^_ÐUSWVu_uO@@tC@HtGt?=u(h@SO& u=^_[Ð=6 u3^_[UWV=4G@t54G@@4G@jjh@ ~2h@ NW tW- 4G@^_ÐUV5 @ED@uF FFF FFfF^ÐUWVu= @V%w ȉOGfffG^_ÐUVu @FfFF5 @^UV5 @~t!>| 6UF @^Ð3^ÐUE ME u3^_[ÐEEHEE9EEEE4V }E̐ ~ E@EED^_[UWVuD@tKM EFPu W56fD@tWK  tj j e  u^_ÐU WVu@@@HtFt>=eu=FE GE t w w VWh8@wP u&uPch=@j.ojh@@w( hD@w uEhP@w u E~h\@w u E^hd@w u E>hp@wz u Eh|@wZ uEuPbh@uh@u[^_UVu6u ^ÐUEx u u PÐUE@th@pmfD@t-}@th@Ep u@h@E뼐E@t*p;u@E@E@}@uu   @u E P EH}@u7Ð}\@tD@t)}@t}@u=@uEp `ÐUSWVT3EE0PD@+D@EVWqPjWW @uF Àu @0u5@(PY uҋE8t5@P; uÀ@0D@ED@PPED@D@E8tE0P DžPÀuf@0tZPh-@PE8E0ZP뾐Àu@05@PA u\u*ءD@D@À@0D@L5@LLP uދL@D@kDžP @fxtjF +FPj ^_[Uu hD@uÐUV}t'uPVu^3^ÐU SWVu=4@Vf uh@V t2wVE u^_[Ã}}߃;͐j3GVGGG GG;UVuu @@u3^u@HtF>u^ÐUE/@54@UVu t6V/@v^ÐUVxD@t=(D@t(D@P5E@t5ph@Ep>h@u2Ep t(p^j=VKj ^ÐUWVu5D@v'Wh@Wv +D@@P^_UWVu~t?tvFv {Fv (v]F uF~ t/@^_UVuFt,h@]j vHj ^UVuFt,h@!j v j ^UV5 @>u^Ðjv>u^UEx tP /@/@ÐUV/@h;e/@P15/@h<</@/@^ÐUWVu=4@Vf u3^_Ð}}? twVPE uڋ^_UWVuV Gth@V@t @t@tD@t@uh4@VfD@t h@V uh@VGtVW8w w3GG GD@t-@u 5@@u=@u j|^_ÐUD@u$=XD@t5XD@<hD@ÐUVu tV(HPV5@ ^ÐU}tjEP5@ ÐUSWVEiE EdEEE}E<ڋEE}EE tVjhWjmSjs^_[ÐUuhD@ÐUSWVD@E}'0+E EtE0F+ E+u؃ű0FF^_[USWVu3"ÉE@t t |0k FÀt |9uuhh@u%^_[Ð^_[ÐUE &Mx&E 0ED@EE}D@ED@PÐU=@t4@ƀ/@h/@HPh/@j @ÐU}t+@@=|@@M/@ÐjEPj: ÐUVuyN@=|H|Vuj ^Ð@/@Pu5@^ÐU@ÐU SVK] s ^FC@Fu ^F?F^E-/@=|h/@/@EE uh/@e^[ÐUu]hD@ÐUSWVf8G@fEE8p %E>jD@]} tLf=8G@<|h@V8G@M D@u/f 8G@f8G@ɉD@tHEP7SVWPnDh @<h @;ǀtLVhH@E uu譼ΐV؃ |h@V_SdR uVBfD@t h@ː@t jV |jjSټ V | uSE@ E}^E^_[ÐUEEuj/: tEE8/t󐐋EÐU SWVuj/  t.fD@th@u^_[Ð-@^_[Ð5@ u 4@^_[V"K~;|:u4|:t-l SVW :DP ^_[ÐV: ^_[ÐUSWVu} jWV( j5D@讻 } u؋^_[ÐUSWVu ?:t GC?u;t/C?:uG?t3} GC u} t KGC u^_[ÐUWVu?:tG?u?:uG?t^_3^_ÐUWV}u3^_Ë=h@ tu>t>:u?t?:u ^_Ð8t?t ?:tGFGɀ?tGU SWVEEEM<uEEPE u E^_[ÐE@E@@u- M1 u  ƃPmMAExu M HZE@E:tEEM E E  uEM9HtE/uE0 Pu MuEM 1L0M}E^_[UWV}D@0@|@7f} }f3 fE f%`fEe 4G@E0@f} EEVE ;EuE= t=@t+=`t0E E@}u#}u+E@搐E@ڐuVW Euu57WV u50@7^_ÐU SWVu j6u ؋=D@WxD@t!=(D@t (D@P50@VW` L@ D@D@8D@D@D@[ @E t P藶W @WV|jhD@`hd@WhD@WhX@Wh@Wh@Wh@Wuh@Wg0@l@^_[ÐtStTtUtVtѐUV0@ 0@0@;s0@^ÐUV0@}t%>u=0@|0@E^ÐU$SWVEE0@EuE0@EPa=D@t4D@} s93u 0@EE0@;s׃uN} t<0@ 9EtE0@;s9E 0@=L@ EEE% uh@} @u hH@T=@s @D@UD@ÐUWVuF=D@F$D@D@^_ÐUVu5D@D@D@95D@wޡD@;wƣD@D@V^ÐUD@+D@=~ h=UPu PFUWVu} uO^_US]8]u [ÐE E E u3[UWVu} Gu 3^_ÐF8FtN+^_ÐUVu tF~u+E^ÐUSWVu} ] >t K ^_[ÐUSVEED@D@Àu @u#u؀ t uã$D@ɐÀu@>'u>u't\FF^ u葳 u9u"F"F~F^\u~F=u E D@Àu @HuEÀu?@@t3]8]t& u\u#FF^ uÀ2@>"VE@u @@@u D@À̀0D@Exu:@Eu0E@t#>t/tE>u 1@^_[Ð0@>t1@tF>/u=1@uh@@E u3^_[Ðh1@"E tEuRE tEf8th0@ PcEE9Ẽ}tƿ5@] C uEE uu}o5@EEG uMUWVu} F8FtAN>t| tg~tAt;8Gu48Fu-GPFPp t^_Gu3^_ÐGPFPC t ^_ÐWFP& u?tGPV u͸^_UWVu} Gu ^_F8Ft3^_ÐU`SWVfExD@t =(D@t (D@P}u%D@u _f=F@QE EE %E>%EP B. ;0@zu܋pgE(D@@th@ptfD@t3}ؤ@th@Epm uh@Ep6E@tPd0Ep eEpWE@ E؀`=D@tE܋@E؋M܋IHE؀HEp(D@tD@xD@=(D@(D@F@EԋFE(D@F@VPEP ؋CE܋EԣF@}tv j3 fE҃}tfEf%fEf=u jv }} D@p fD@t Sf}u=fEfEf=uh|@3Rf}u hl@ᐐhX@ؐf}u fE fE tfEfEfEf%`f E f} E҉EăPufE‹EăM .$h} uuPE }h|@u uj~ EPMu$j 6uj ! D@@}tutD@PŽE =,D@ F@fF@}tuF@,D@9F@~ F@ F@ =,D@ F@fF@}tuiF@,D@9F@p 뢐}Eu@tff3fEf u;- 3E} | uh@3ZȐf}t uau܋EF@PE܀8t u莿uPɐEEEfD@th@3{ D@@t)Ct}tuE)PD@yPD@h@뼐ETD@j}tuPaB}}h@3 F@CP(D@F@}t.Su葦EjE+EPS~ Jh:@(D@}t;39Hh$<(D@}t<;3E@th@cҐEHǐh`<i}CPu E}t0E܀8-u(@fth@ ECE܃}t]EEEEEu @u}u}}9h@豷*kE E0E }h@葷EMuuHE } h@c}t }uX}t>EEE0E |~uG0EEEːjGEPGj0EEM$0Pm}}Su+(D@Suk (D@}tPE܀8-u;xru 詾h@o3fuh|@3;uW(D@#l=D@u h@fF@}tu3tD@&(D@} 3;u(D@} 3 ;uCE}}h@3蜶%(D@h@Ep f@@}~TD@CsCPEȃs5TD@PD@@P誙 EuL5@@hD@uau:Eh-@PE(D@EC5@@[hD@uEEEuEEPuh@E5H@Ph@/bp``6`_0^8bbh^^c]tjE0~EptE0ӔjEpKt!=D@ujhp@P"jv}tuE Pvs 6;t/4D@jv ;jEPSKuu v% 5EP4EPuujv uuEPuu vuГuœdujv jjv h@6V裎 |"PV t؃ u^_[ÐUSWVEMuj @3^_[Ðjh@E pq u EE MPũE 4 jF>>\Fctwp0t'\tbtxj j j j j j\3ۉ]FEE} )@uSqN덐00 ftntrtttvtNPG}t9}t9}u  P G9}xD@=(D@(D@U\SWVfEEEEEEF@ExD@t 3^_[Ð}fEf3GG/t8wZ t *t>鐐} tf}t;uS-@>fE뵐fCf tE;E |OȐG뛐?t[tڃ\t]t널O?/uO;r?\ufEEG;u@냐VEPue @PaE tfE}tuE?u GE}tGf}߀;/u)K;\t C]ECEF@C{uExD@uMEx .u?.u-WE P8$ tuuԋE PV"EuL6E uu}t_F@EEF@}t1E"E@PEPE܋EE}uڃ}t MԋE\E/}t}t E\E/E^_[ÐU(WV6@EPu[ |!fEf%f=@uju }3^_Ð>3FFF 7@^_ÐUVu6^UWVu}tG uE@;u/u ?\uG\G uu t /F uWP ^_ÐUVuF@5F@^ÐUEpUWVu t^_Ð>ǃP/ tCtj 0@Fv蘘v)vXv%v v8vupCEp1Ex @ pE@ pE@ p Ep Xv?vvv $v謗v=t`tpt+=t===VV^_ÐUWVu>V4 u^_ÐUWVugt;v譈95D@u FD@D@E@E9puNHv̖v~ V赖 u^_UWVu&6Ev~Vz u^_ÐU SWVuxD@t!=(D@t (D@P9 t|>ǃP   0@5sZh @MsZh@5xD@=(D@(D@v vvvvfth@h@vh @lvh$@vJvj vxh(@vdh0@뮐uh8@3Ep%Ex t1@ Xh@@ j CP uhD@EphL@PuhT@h\@vhd@vhl@@uht@kEpuhx@PEpZEx th@,Ep 6h@h@v^ E t(h@EPEE}uh@sh@[=`p]6= =f==P譞^_[ÐUVu u^ÐFPj 6 u^ÐUSWVu>^;t%Pth@Eǀt th@h@ؐ uj<@th@뼐j>S`j v l^_[ÐUS]}=$;@t]}\ueD@D@M"Eu E@uD@D@\D@D@\D@D@M,}\uED@D@\D@D@Mu PE:JD@8]t h@ל[ÐUS]mE t::t6E"t$t`uj`ѐj"7<{uj}␐8]t h@q[ÐU4SWVÀu @Au ^_[Ð$#EE@mEEEډE}{ffEf tEEE@@D@+D@%E@HtD@D@MBEEtաD@D@PE܋D@D@E@t h@QE܋x @EÈ$D@EE@ EMEEu:E@t-}@u}u=$;@t %;@EEE1E0E uXD@!E;PD@wE TD@3Ew}$u =D@f}!u =F@V}#u5PD@?D@9}?u 5tD@␐}-u 8D@f}h@E<:uf}tfEEfEEu E@uf}t h@ʙ3f}t~}}D@+D@ t f}t ?u3EEuE@t33Etu j} j}D@È$D@E f}t ?}+?u\=$;@tSD@D@\D@D@?=$;@u }\u} tD@D@\D@D@MGE uÃ}:EPD@9E)E TD@>tt@PuΗ}=}D@+D@E5D@EL&}\u} tE tD@D@ME u5D@mEPu.uuu5D@x| ED@D@h@FD@h@ È$D@8]`u u 벀"=$;@u E%;@5$;@nU(SVf%;@f$;@EPfu$;@%;@jj\=%;@t$D@9D@uD@\D@D@$;@fƢ%;@5D@ ^[ÐUSWVD@+D@T5D@EqM tR\u4Àu@t"u=$;@uD@D@\D@D@M؀`u5D@gXP:Wjh:Ph載HP迧L@H^HPjD@%PjWgLYy@uTu5D@y TD@D@0=$;@u \u}tD@D@\D@D@4 ujju' D@D@8 tD@=$;@t D@95D@u$^_[ÐUSV`PإuAP\u+Àu@t"uD@D@\D@D@Nuu 0jj"K uu ~^[ÐU졼D@+D@P5D@u7y fD@t D@+D@P5D@5@ y D@D@ÐU SWVuV"ހ>/u1.;.u{/uSCP;/tC;u;tC;uK;.u;vK;/u;vCV>.u~t}>/t 8,;@u T;@},=@tXhT;@S;@}U;@t/VD=TA@v@^_[Ð uu6^_[ÐU=@ugjhT;@蠷j JUVu>/u~/uVFPoF>uN9us>/u^ÐUxWVE@E*EjjhT;@hu!hT;@hX;@@^_ÐEƀT;@Eƀ@EPuv } h@/Eƀ@.}uu E u h@EPE0u }u5h @̐fEf9EfEf9EuE@u}u MEƀT;@/hT;@ET;@P^_u E uuh @EEfMf9uPuP&HEEƄ/uE uuBh8@ُEPE PSEPPufEf9EufEf9EuuEEEEx uEH;E}ht@^-E)EPET;@PE Pp MEƀT;@/m}@ht@U0WVupGF>/t;v WVo>.uF t.t/t=NVF ~/t~uNT;@vN>/uVW>/tF>uEPhT;@@t3ff%f=u0hPhT;@ @u@^_ÊEff%f=u}~tPVy/uhT;@P\T;@9P΁T;@H=oVP>T;@u/F>/u NT;@wu@^_ÐUWVjjh(;@h]TA@jjh(;@hBTA@ |F5(;@u-;@,;@ u,;@VWh@;@gr Ɔ@;@TA@^_3^_ÐUeEhT;@}t h@;@UWVuVO;tB+=(;@h@;@qEPWh@;@q u }VW>u/F^_USVuu=(;@u8,;@t8-;@uF u t+E;(;@|^[ÐE^[ÐUuuu uh(ÐUVupEƣD@^ÐUE|G@E G@xG@hP@0? u5hR@E |G@ |G@4 thT@h`@E |G@=|G@ ÐSÐU|G@9xG@|"}t xG@3hh@h|@聊xG@xG@ G@U=EjE th@P^ u EÐ xG@EÐU=Ej[E th@P u #EÐ xG@EÐUh@jP uÐ xG@ÐUVjh@V u?Eh@jPv th@h@@Ej}E xG@ t.h@P2 h@u h@V u)jhjP~ h@Vɿ u jhÐh@V譿 ujj@h@V蕿 uh@jP^Ðh@Ve u h ΐh@VI u h`벐h@V- u h떐h@V th@V u0fXA@hjPREfXA@^h@V轾 uhjP#h@V葾 u hҐh@Vu u h붐h@VY u hh@V= uj_P^h@V uZ|G@9xG@| jlh@jV th@VϽ u xG@VkPh@V詽 u"h@jP荽@^Ðh@Vu uh@jPYnjyE u h@V륐h@u' th@u u xG@h@Őh@u uVyh@uӼ uV)VjEjPjEh @u蕼 uE9E^Ðh@uo u E9Eؐh@uO u E9E븐h@u/ u E9E또h@u uE9Euh @u uE9EQuh@h@ ^U EPu>j }3ÐE#E ;E uÐU f=XA@tEPuEPui }3ÐE%;E uÐU EPui }3Ð}U̦u} t#hD@u ڦuϦj jÐUWVu @=$@tEP,vE u ^_ÐP5 @uh 5 @w3$@PuE tP5 @uRh E @ML8 @D8 @M 3^_ÐUSWVu3VS) t ^_[ÐG @ uG^_[ÐUWVu} >=u ^_ÐFG8Gt3^_ÐUSVuF^E E E _*?[t\EEEE 8!u EE E E E t<]u}3^[Ð}-uB}~"u VF tא^[ÐU\A@|ÐU=\A@uyL@Ehj (f`A@u u.E=\A@|t\A@| tL@E5`A@j eEL@=\A@|tEÐu u\A@ÐUWVj*ju  3U}#E kME 8GE)@u؋E8u3^_Ð t t5$EE8_u F}/3뼐Ex.t ^_ÐFܐEE8.t䐐^_UWV3%kE<8ujE PEPe F|^_ÐUjh @j#e u dPu j e jh @jd E.$E @u dPu jd j"h @jd jh!@jd jh(@Րjh$!@jzd jh<@jid j h(!@jh<@jNd jh4!@륐jhH!@낐jh`!@sj ht!@g(Dpjh!@jcU4h!@uc uE< @uu t ÐE8txt x>u 4 E t1EPub tu j5EPuE8txt xh!@ E t0EPu tu jEPuE8txt xh(@ t$E8uxu xu jEh<@E EPui tu j<}t}t}t܋E8tEPub tvExtEPEPa tFExtEPEPa tEPuOE}jP}u u j]E8t xtxu EPh< @TEPu3ÐU=P @|5P @_}t ju`P @ } Ð3Ujj5P @3` Eu`EhhdA@5P @K` E ~3EdA@EEE8 t EM}u}u2}dA@u3Ðju5P @_ }tEEÐEE+E@Euuu!` tME@EwUVEPkEHH@u , t3^h!@EP E-h!@EPV jkEDPEP E}|h!@EP% kEH@EP jEP^|@u)}tkEHH@j6Q!@^jEP|^ |kEHM8@t(kEHH@j|]|kEH|@E|]}tkEHH@j^kEHL@jEPV h!@kEHL@P jEPkEHL@P h!@kEHL@PjEPkEHL@Pk HEL@^ÐUWVEEdB@} }3gdB@^_Ðh!@hdB@]kHL@PhdB@GkH@t!@PL@Pn] tEFkHH@u}tL@^_Ð3kHE9D@u L@^_ÐFkHH@u3^_Ð}hu hdB@ ] rC@=dB@/uEEeB@EdB@3juV E tF}u$}t*EEj/P\E tEkHH@uE ^_Ð3FkHH@DkHM9D@uju VJ ^_ÐUV}|+EERkH8@^Ð!@^U}uuj t3ÐU츫!@ÐUhD=hu=t3^_ÐV|$3O|$ L$Oϋt$ +D$^Ð+TÐUhPuU =|hPuU =}hPh)@U hPh'@rU 3ÐUWVuE~t~~ FEGFF9F|3FF~u+hv 6( F  uEF3^_Ð~~ ^_øQSÐV|$3O|$ ыt$ D$^W֋|$ 3ыt$ |$ȁD$_Ð?TSÐ<@SÐW|$D$ L$~% ‹ʁD$_ÐRL$tÐRT$RÐUu1@u3Uu@u3ÐEÐU=@/@ uÐ@/@M .@@/@3ÐUV5@/@Ny^Ð.@Ny^Ð/tmp/sh-tC@SHELLrshrsh-rsh600OPTIND1xnvtsierkuhfa @setsicrsicrnewline or ;||||||||||||||bad option(s)you have mail no spaceno stack spacesyntax errorbad numberparameter null or not setparameter not setbad substitutioncannot createfork failed - too many processescannot fork: no swap spacerestrictedcannot make pipecannot open - core dumpedarg list too longtext busytoo bigcannot executenot foundbad file numbercannot shiftbad directorybad trapis read onlyis not an identifierBad ulimitcannot return when not in functioncannot export functionscannot unsetno home directoryexecute permission deniedsh error: pwd too longmissing argumentscan't access a needed shared libraryaccessing a corrupted shared library.lib section in a.out corruptedattempting to link in too many libsMultihop attemptednull directorynot a directorydoes not existpermission deniedremote link inactivecannot open any more filestestunknown operator PATHDOSPATHCDPATHHOMEMAILIFSPS1PS2MAILCHECKSHACCTMAILPATH :/bin:/usr/bin: -end of file unexpected at line /dev/null+ > $ # .profile/etc/profilevpix-c.com.exe.bat@@@!@@@"@@@@ @$@@@@(@@@@(@0@<@P@X@d@t@@@@@@@exportcannot dupreadonly@ @@@ @@ @@ @@ @@@$@,@0@8@ D@L@P@X@`@h@p@x@@@@casedodoneelifelseesacfiforifinthenuntilwhile{}HangupQuitIllegal instructionTrace/BPT trapabortEMT trapFloating exceptionKilledBus errorMemory faultBad system callAlarm callTerminatedSignal 16Signal 17Child deathPower Fail.:[breakcdcontinueechoevalexecexitexportgetoptshashnewgrppwdreadreadonlyreturnsetshifttesttimestraptypeulimitumaskunsetwaithits cost command is a shell builtin is a function (){ } not found is hashed () is a shell builtin is not found @,@ @@\@@$@@@t@@@@@@@D@@@@@@LANGLC_LC_CTYPELC_NUMERICLC_TIMELC_COLLATELC_MESSAGESLC_MONETARYSHELL(){ } =SHELLptrace: Signal .SHELL...OPTINDOPTARGunknown builtin cd ? ok   ""@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@-n/.(){ } &( ) | && || for in do donewhile until do doneif then else ficase | );;<<>&<&>>../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../../..pwd: cannot stat .pwd: cannot open ..pwd: cannot stat ..pwd: read error in ..pwd: read error in ..[]] missingtestargument expectedtest-o-a!()) expectedtest=!=-r-w-x-d-c-b-f-L-h-u-g-k-p-s-t-a-o-n-z-a-o=!=-eq-ne-gt-lt-ge-le/etc/default/langLANG=T @english_us.ascii0` @h @english_us.ascii\t @| @english_us.ascii@ @ @english_us.asciiȥ @ @english_us.ascii4p @ @english_us.asciiԦ @english_us.asciiLC_CTYPEctypeLC_NUMERICnumericLC_TIMEtimeLC_COLLATEcollateLC_MESSAGESmessagesLC_MONETARYcurrencylibc: setlocale: : LANG environment variable syntax errorunable to open no line in syntax error in cannot open locale filecorrupt locale fileunknown error CLANG/usr/lib/lang//_./      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~yn-$ +29AKT[dhlptx|%m/%d/%y%H:%M:%SAMPM%a %b %d %X %Z %YSundayMondayTuesdayWednesdayThursdayFridaySaturdaySunMonTueWedThuFriSatJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberJanFebMarAprMayJunJulAugSepOctNovDecHZ  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ ((((( H O@O@-@O@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL+ d30/D p@.textppd3p .data@@0/4@.bss4@4@D .fka000C".fka040@@LB.fka041L@L@.comment"d.lib&d@8+@@P4@@X8@ @`<@$@.@(@2@,@2@@ @@)@4@0@H>@8@@ÐET@RU RPWh@j*L@ P1jUWVh,4@hXj @u=L4@h4@hxja @uV5 @j{1<L4@24@$4@f84@f4@f:4@f4@f64@f4@@4@D4@H4@h@4@h"Tj |D4@}u+ j0}E @8-E @xE @@at gt j0j05 @h@kE E 4@4@=L4@h@ t"MtE E 04@3h@ tMtE E 0X4@ːh@n tMtE E 0(4@뛐h@> t#MtE E 0!4@hh@  tMtE E 0ʐh@ t#MtE E 0"4@ h@ tMtE E 0-ʐh@ t#MtE E 0@ 4@h@R t#MtE E 0 $4@|h@ t4@ 4@Uh@ t#MtE E 0(4@$h@ t#MtE E 0)4@h@ t#MtE E 0L'4@h@^ t#MtE E 04@h@* t!4@"4@ah@h@ t!4@"4@.h$@ t?4@ 4@4@4@!4@"4@$4@'4@h,@ t+Mt&E E 0Ph4@h4@F ME E 0\Ph4@F<@ t'W t%4@f@f%f 4@=L4@u,h<@ tMtE E 0$4@3Fk 8@ t/W tk @@f!4@f<@f 4@3Fk @ t/WP tk @f!4@f @f 4@=D4@t!hD@ t@4@t @4@=L4@uhL@ t 4@3Fk |@ t/W tk @f!4@f@f 4@3Fk @ t/W tk @f!4@f@f 4@3Xh`@F t H4@k d @!@4@` @ @4@5 4@hp@h.@ Fk \ @ t:W t=D4@thT@ sH4@낐=4@u+2 u"5 4@h@h.@{ j)M}s=L4@uh4@hx:f4@f64@f4@f:4@f4@f84@$4@24@h,4@hXj` @u5 @jz)=D4@h@4@h#Tj$ @u5 @j>)=H4@tC5H4@h kj @u+=H4@u @@Ph@h.@e @4@u/(4@<4@)4@=4@h<4@hAAj %@4@@4@t"<4@e=4@gh<4@hAAjW j(^_ÐU= 4@u3Ðu5 4@ u4@ÐUVEEE4@ tuV uߋE@^ÐUVEEu@tE9@u㋆@^ÐUV=L4@64@th@h@:4@t h@h@{t h@f84@t h@h @?th@h @#th,@h4@th@@hH@hR@=L4@4@%PhT@h4@WPPh\@hh@ h4@RPePht@h@c h@Vtt h@h@h@'t tu(0u %05Ph@@t h@t h@ƀu h@t h@ t h@~@t h@i@t h@Tt h@?h@2=4@t4@Ph@=4@th @h@4@P =4@th@h@4@P] =4@th$@h(@4@P: = 4@th0@h4@ 4@P =!4@th<@h@@!4@P ="4@thD@hH@"4@P =$4@thL@hP@$4@P ='4@thX@h\@'4@P =(4@thd@hh@(4@Ph =)4@thp@ht@)4@PE = @t hz@4@th|@ t h@suh@ t h@Ot h@: u h@%@t h@ƀt h@t h@t h@u h@u h@t h@4@uh@x>t h@[t h@Ft h@1t h@ t h@@tƀth@h$@h0@%P h4@%P h8@%P h<@% P h@@%@@Py hD@%P\ hH@(4@u hL@ u hT@t h`@h@Pp@P x@P@t h@}ƀt h@ht h@St h@>t h@)h@^ÐUV=L4@4@%Ph@1 h4@ PPh@h@ h4@ PPh@h@ h@4@Ph@vh@h@4@P h@h@4@P h@h@4@P h@h @ 4@P h(@h,@!4@P h0@h4@"4@Pi = @t h8@h:@h<@$4@P9 hB@hD@'4@P hJ@hL@(4@P hR@hT@)4@P = @t)hZ@Fh\@h`@24@P 4@h@Pt@P%05Ph@@@P@Pƀ@P@Pe@@PK@P1 @P@@Ph@4@@P@P@P@P @Pe @PK@ @P1ƀ(@P0@P8@Ph@@D@PL@PT@Ph\@{4@`@PXh@P>u*!4@Pht@!"4@Ph@ @P@P@P @P@@Pƀ@Pp@PV@P<@P"=L4@uN@P@P@Ph @4@ @P@P@Pg$@PM,@P3 4@P@@@PƀH@PhP@%PhT@%PhX@%Ph\@% Ph`@%@@P{hd@%P^hh@*=D4@te@4@l@P@4@t4@4@|@P@@Ph@^ÐUWVuF~^u)>?u ^_Ã-u ^_Á^_U @u h@[}uuh@EÐh@3Eth@ e}u uh@뿀} sh@E@uEPh@ ÐU}tuu h@ ÐUE 4 @uh@U@4@t@4@$߉Er tM u'4@P$4@P#4@P"4@P!4@P 4@P4@P4@P4@P4@P4@P4@P4@Ph@ÐUt%4@y V! FFE(jWF P uEE4@E9+@t5E} 4@VEPS Mf]mY 4@VEP+  4@VEP - 4@VEP EFFMxlE;sL@"3^_[9+@u}9+@9+@tC9+@t7W+؉EE9E|h}}}6EPZ]}t E]}lE@VWu_^3}t}u EmEEE܋ê4@VB}R|3@;u EE tet E/}%EE)*+,-./012345678 ê4@yV FF9+@g+^-U9+@CE@EE}t }t]}lt}huE@fMfE@M 4@VS @u 4@E^_[ÐU SWVu} ] tE@3EEcu u4@Ey u EH@E@t5su E9+@u$[u EE8u tEMEK }u4@ 4@& ~! 4@uu @u 4@E9Eu3^_[ t ctE^_[ÐUSWVu} E>^uEFh}PW E]t-u_EM FS}u 3^_[Ð}-u2E]t'F;]}E+@PuP 붐EM FFE]u^_[ÐU SWVu3ۉ]]]F>9+@uǃ+t -uEFEEF~9+@u.uVEE uLF~9+@t>+]0} } mE}붐E}  kE ljECM뙐}u)@^_[ÐEEEteucEE t +t-uEF>9+@t3}} kE ǃ0EF>9+@uރ}t+]]uSuuu^_[ÐUWVu~u VF uF N F Dt$.@9=2@vG @tW3FFF tF 2@+FPvF P xFF^_Ð>tN N F tf ^_ÐÐU8SWVu}6~L@"} *@^_[Á}}L@"*@^_[Ð t}+Ek D-@E?##@EE@M EEE؋E@؋EEp +ƉE~EE]3m}ueeEu %?ME%?E޸F+EEE?EEE؋??e?e?.E???3EEE*E u$]EEEm␐E} E |E)EMeeEEE؋E?e?e???+E P+Ek <,@E@EE@EEE܋E@E؋E@MMMMMMMMMMMEEEԋE@EЋE@MMM؋EMEE@ E]EEEE?E%?E%?E?#߿?#+E%k D-@E@EԋE@E؋EE܋E@EE@MMMMMMMMMMMEEEE@EE@MMM؋EMEE@ EE?E??EEԁ |ME+EE } EE}IEM E̋K EԉE u5 t1E̋Efs"L@"}*@^_[Ð}u E^_[Ðuuu ^_[ÐU}tE*@uEÍEPu uE P@}~B} EE=~TL@"E*@s $*@Ð,*@Á}| EE=}L@"*@uu u ÐUhPug =|hPuI =}hPh8+@ hPh4*@ 3ÐxÐUVu }u ^ÐF tF9FwF9Fu߃>uF~u VCNFME^UEEf%Etf=Du]ÐT$ÐUu1@u3Uu@u3ÐEÐU=4@ uÐ4@M 3@4@3ÐUV54@Ny^Ð3@Ny^Ð @@@@ @@@@ @$@(@ 0@ 8@ @@ H@ P@X@`@h@p@00x@00@00@ 0@ 0@ 0@@@@@00@ 0@0@0@@@@@@@@@@ @@@@@$@,@ 4@ @@@H@@T@00X@ 0`@ 0h@p@x@@@@@@@@@@@@ @ @@@@@@@@@@@ @(@0@8@@@H@P@X@`@h@p@x@|@&@&@@@@@@@@@@@@@@@@ @ @ @ $@@,@@4@<@D@H@P@X@+`@h@t@|@@@@@@@@@@@@@@@@@@ @@(@@$@,@4@<@ D@ L@@T@\@@h@t@@|@@@@@@@@@@@@@@@@@@@@@@@@ @ @@@@@@ @(@,@4@<@H@T@`@l@ x@ @@2Kn,X` %K05075110134134.5150200300600120018002400480096001920019.23840038.4-parity-evenp-oddpparityevenpoddpparenb-parenbparodd-paroddcs8cs7cs6cs5cstopb-cstopbhupclhup-hupcl-hupclocal-clocalloblk-loblkcread-creadctsflow-ctsflowrtsflow-rtsflowraw-rawcookedsaneortsfl-ortsflignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnl-nlnliuclc-iuclclcase-lcaseLCASE-LCASEixon-ixonixany-ixanyixoff-ixoffraw-rawcookedsaneisig-isigicanon-icanonxcase-xcaselcase-lcaseLCASE-LCASEecho-echoechoe-echoeechok-echoklfkc-lfkcechonl-echonlnoflsh-noflshraw-rawcookedsanestflush-stflushstwrap-stwrapstappl-stappliexten-iextentostop-tostopxclude-xcludeopost-opostolcuc-olcuclcase-lcaseLCASE-LCASEonlcr-onlcr-nlnlocrnl-ocrnlonocr-onocronlret-onlretfill-fillnul-filldel-fillofill-ofillofdel-ofdelcr0cr1cr2cr3tab0tabstab1tab2tab3-tabsnl0nl1ff0ff1vt0vt1bs0bs1raw-rawcookedtty33tn300ti700vt05tektty37saneisscancode-isscancodexscancode-xscancodecs2scancode-cs2scancodesttyusage: stty [-ag] [modes] %seraseintrquiteofmineoltimekillswtchekstartstopsusplineraw-rawcookedsaneispeedospeedctabsanesanecs2scancode-cs2scancodestty: unavailable mode: %s stty: unknown mode: %s KBM_ATKBM_XTstty: Could not set keyboard mode %s iuclc -iuclc olcuc -olcuc tab3 xcase -xcase stflush -stflush stwrap -stwrap stappl -stappl speed ispeed %s%s baud; ospeed %s%s baud; oddp evenp -parity cs%c cstopb hupcl cread clocal ctsflow rtsflow loblk ortsfl line = %d; ; intr; quit; erase; kill; eof; eol; swtch; susp; start; start ignbrk brkint -inpck ignpar parmrk -istrip inlcr igncr icrnl iuclc -ixon -ixany ixoff -opost olcuc onlcr ocrnl onocr onlret del-fill nul-fill crnltabbsvtff -isig -icanon xcase -echo -echoe -echok echonl noflsh iextent tostop xclude speed ispeed %s%s baud; ospeed %s%s baud; line = %d; ; intr; quit; erase; kill; eof; eol ;swtch;susp;start;stop ctab-parenb -parodd cs%c -cstopb -hupcl -cread -clocal -loblk -ortsfl -ctsflow -rtsflow -ignbrk -brkint -ignpar -parmrk -inpck -istrip -inlcr -igncr -icrnl -iuclc -ixon -ixany -ixoff -isig -icanon min = %d time = %d -xcase -echo -echoe -echok -echonl -noflsh -iexten -tostop -xclude -stflush -stwrap -stappl -opost -olcuc -onlcr -ocrnl -onocr -onlret -ofill -ofdel crnltabbsvtff -isscancode -xscancode -cs2scancode %s %s = -DEL%s^%c%s%s%d %s%d baud; %x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%lx %x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%lx%s: %s %d %s Error@@@@@@ @(@<@P@`@t@@@@@@@@@@ @0@D@X@l@@@@@@@@@ @( @D @X @t @ @ @ @ @ @!@!@?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ ((((( H @:'i _;?U3R)E?98p)D5} [%/ -I /wb5,6)6d>n G79 85q&5 1Z$.H+jt'!]6$J !5w%^_KLza N } dP@fff&h&QG!+ A j<h"2S58C7{-_k2+/4 U# >D K) m5\W?YU }?^Fz !%ph]( ZJ(9H/9Y!,p<@p<@2@x<@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL+ Dtp@.textppDp .data@@@.bss@@@@.fka000C".fka040@@LB.fka041L@L@.comment"@.libbÐET@RU RPh@j?L@ P8jUjÐÐ$ÐT$ÐÐUu1@u3Uu@u3ÐEÐU=<@ uÐ<@M @<@3ÐUV5<@Ny^Ð@Ny^ÐL@Ð@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_s...binPlib...menu_addmenu_delKcompressKuncompressKzcatLgetoptMmapkeyNtarOtputLz+ UG'p@.textppUp .data@@GW@.bssN@N@'.fka000C".fka040@@LB.fka041L@L@.comment".lib@H@4@0@v@8@@@tZ@@|^@ @b@$@I@(@|M@,@M@@ @@G@ÐET@RU RPWh@j*L@ PTjUWVEEhY@hTjq }hI@hx@jSVWY@Y@f_^fY@f%fpZ@E Eԃ}uE @8-uE @xuY@ME E 0>-nF>XY@_FFdAEt>IQSNVh@ Y@Y@>u Y@>^u~t F$Y@F>uY@>^u~t F$Y@ƐY@@8@ Y@8@@>uu E uM 8@p8@ E辚@$Y@@릀>uu E uMA H@t8@0H@tF񐐡8@@EE}tQ}t8@ȊIрH>uu E uM 8@p@8@ EieuVX  8@AH@u >.F=t>t@tBt믐Y@Y@Y@~Y@Y@jY@`Y@XY@Pe5.$,YYYYYPYYDYp>5Y@Mq=Y@t6}t&8@@8@@8@ Y@H Y@Y@=Y@u!}u=Y@uh@Y@=Y@u*=@u!=Y@t =Y@uj]K@=Y@u5@EY@=Y@u Y@@}tpZ@P5Y@Y@Y@8?u Y@Y@Y@8u Y@@=Y@tV5Y@h@hI@ hI@j1EPjq ||= uOD=}tEY@=Y@EE@=Y@tT=Y@ hY@h"Tj @Y@bHE |EEE t3HE u~5Y@h@XP XPA u:I@PI@P< |juh@h@b<h@h@^jLMEPL;Eth@6 }jMh @jM5Y@h @XP XP.A uCI@PI@P6; |'j5Y@h @h @h @;h( @h0 @jtLEPK;Eth8 @^}t!jCLh@ @>j,LEEPI@P5Y@ Et( t@t]hx @hI@"jKGhH @hI@jK5Y@hh @hI@ jK@th @ tCVBE t3VP$VEu>u 3E 3E؉E=Y@t }uY@}uEE=Y@u-h @u u=Y@u}u}tY@=Y@}}tEY@=Y@uY@=Y@t Y@Y@=Y@uY@=Y@t Y@Y@ Y@ Y@ Y@jhY@hY@ thY@hTj =Y@h @L u/:X t_PA;P tL@ L t?LPh@^%@E t=Y@t h @}u h @o=Y@tX}tB=Y@t h @@5Y@h @-=Y@ttjuV E8@@.$XE8@f@f;E E8@f@f;E ␡8@f@f;E ΐ8@f@f;E 뺐8@f@f;E 릐8@f@f;E 뒐0D}t8@@^Ð8@ 8@0 E^U}E 0hp @,E E 8-uE 0h @ E ÐUh @u uh @hI@jIEÐU WVu} t u3^_ÉulZ@+ljEPWVV u}Wh@ E uWVE^_Ð4 @rtnQhTlPD +ÐUSWV]Cs;u;tu ^_[Ð^_[UDSWV}hJ @E} E80 @EDž} EhO @{>uVǃ=fH @ VPP/FEF/FuVjP:=L@ |UhX @PXPNEFuV.jPr=L@ fH @Bjhm @fH @fH @} Euh u@hP3 >fH @~fH @[ld@S8SSSSSDž=D @h4 @=4 @j&8 @=8 @\j>< @=< @-h@ @=@ @c5< @58 @54 @fH @} H @P|@ ID @4 @dj@8 @o@< @0o@@ @po@x Džd@@#=@ @po@5@ @%} Eju4 @P 4 @ƀ4 @ 8 @4 @ < @4 @ @ @4 @4 @ǀ4 @ 4 @} u E 4 @fM fl54 @4 @fǀ@4 @ 4 @@4 @ 4 @B4 @ 4 @B4 @ 4 @4 @ƀ4 @ǀ4 @ 4 @4 @ 4 @j4j4 @P 4 @ 4 @Vnf^SV 8 @%58 @%C9 $F9+PjVB C=< @< @<JS9' f ff9+%PhW Phju L @;.!< @ffH< @ffh @h @-< @ffH,< @ff=@ @@ @OS9,9+%PjW S 4 @$<4 @fj4 @x@ @@ @ @ @ j58 @54 @n j5< @4 @PU hD5@ @4 @(P9 4 @L@ @Dž K @4 @ @ p4 @44 @< @fx*4 @x4 @fx < @f@Džh @<(04_4 @ @ 4 @ǀDž @m(048E44 @v4 @ @!34 @ 4 @I\t4 @ 4 @Ihx4 @ 4 @Ix|^_[UE+ɉfffffhjPPá4 @tQhTlP +Ð4 @nQhTlP +UEPju |8EÐUSWV]u }u u2+^_[À;t*;$u{t OCF uыE^_[ÐUSV]C -nc-tG -tgj%EPhD'@h @SE8 @E})jEP4 @p`% t >u~t\+^[ÐjEP4 @@ t؀> uӀ~u'jEP4 @p0 t > u~t^[á4 @,^[ËEE^[ÐU S]jPh'@h @SE< @E}u [ÐEMA[ÐUSV]u jkPhX(@h, @SnE@ @E}u+^[ËEME t>tP6u@E^[Ðh@hI@h u@H @4 @hI@ h@hI@ÐUS]8 @Ejj%ht@h,@SE@u [ÐEE[US]< @Ejjh @hx@SjE@u [ÐEMA[ÐUS]@ @Ejhkh@h@SE@u [ÐEM[USV+ۋuN;vƙ+E}uM AM4u uEM AM4u E }u룐}~]C떋EM A^[Ð^[ÐUWVu t%uFj/V> u^_ÐUWVuDžp}uE.@h.@u gh.@P+*| tFh .@j*t t-VP u|u }WW^_ÐWhPV uW0puu 9p^_UV<.@=L@|0@9L@} L@4D.@}tE8tPh(.@hI@ 5L@V<.@u 0.@8.@PhI@^ÐUWVj*ju * 3U}#E kME 8GEH@u؋E8u3^_Ð t t5$EE8_u F}/3뼐Ex.t ^_ÐFܐEE8.t䐐^_UWV3%kE<8ujE PEP F|^_ÐUjh?@j u Pu j jh?@j E.$&E ?@u fPu j j"h?@j~ jh?@jf jh<@Րjh?@jJ jh=@j9 j h?@jh=@j jh?@륐jh@@낐jh(@@sj h<@@g'& &X&t&&&&&jhJ@@jU4hL@@uh uE?@uu t ÐE8txt x>u fE t1EPub tu j5EPuE8txt xhP@@ E t0EPu tu jEPuGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdE8txt xh<@ t$E8uxu xu jEh=@E EPui tu j<}t}t}t܋E8tEPu tvExtEPEP tFExtEPEPq tEPuOE}jP}u u j]E8t xtxu EPh?@TEPu3ÐU=?@|5?@}t juZ?@ } Ð3Ujj5?@ EuEhh0O@5?@ E ~3E0O@EEE8 t EM}u}u2}0O@u3Ðju5?@ }tEEÐEE+E@Euuu tME@EwUVEPkEH=@u , t3^hX@@EPE-hf@@EP6*jkEDPEP% E}|hh@@EP*kEHP=@EP)jEP|@u)}tkEH=@j6Qj@@^jEP| |kEHM8L=@t(kEH=@j|y|kEHD=@E|O}tkEH=@j^kEH=@jEPV$ hl@@kEH=@P(jEPkEH=@PZ$ hn@@kEH=@P(jEPkEH=@P+$ HE=@^ÐUWVEE0P@} }3g0P@^_Ðhp@@h0P@=(kH=@Ph0P@'(kHX=@t!\=@P=@P> tEFkH=@u}t=@^_Ð3kHE9 =@u =@^_ÐFkH=@u3^_Ð}hu h0P@ >Q@=0P@/uEE1P@E0P@3juV E tF}u$}t*EEj/PdE tEkH=@uE ^_Ð3FkH=@DkHM9 =@uju VJ ^_ÐUV}|+EERkH=@^Ðr@@^U}uuj t3ÐUs@@ÐUhD=h tF~t먐>tFv@fGf%fffEGDPjyEEPEPEP EM u;SjEEM tWV E u+jWV uuV몐GEWEPEP EM u#ދEM tM8t}}F\M8tWEPEP> EM uދEM tF~uF~usDPEPEP &EPPVW" 6uԋEM uҋދEM t EPPVW uuԃ}}Fu뿐EPjVW @uEPjGG4Lu@4tu@O u@bF~t> tF>uF}NF8FGF8FtGאGPV  G%EGPjSuVjWVE uj&E]EPPVW uԋލEPtu 3PVWV tuАu@j CWV E ;!576D5633333333p6d64576D53333333333333333333344443333666663333C68656666^_[ÐU졐v@9v@rjhF@j j}tv@v@M Ðv@-v@M U}t=v@u@r-v@v@Ð=v@v@v3Ãv@v@ېUEME E8uE NÐE M U+ ÐU0SVE8[t ^[ÐEEEE E E EE E}tEE:]uEEE @ u ^[Ð-uK}~EE8]t=E EE؋Ȋ HM؋E9EsE EE9E^[ÐE E[9E8=-EE E IE E EEE8[x.EE E HE E EEEE tExt }.ux]u}}~E E ME E뵐E8xEE܊MEEE E ME EEE Ex}=x]yEEMEE[E8.EE E HE E EEEE tExt }.ux]u}}~E E ME E봐E8xEE܊MEI[E8:EE E J2EՈEJu+u VE uE^_[Ã}})^_[À>Hu'uu V E t |u+}T>Iuuu VsҐ>#FOE>IuSuu VG E | m+EDEE؊ AQ@H}u E@?EDE2>uFOEDEE M@@HE M@@HFOE}}[>J>H]uu V E  +EDEE؊ AQ@HE؊ @Q@H랐EMEEMEE9EJÉE%x@@Mԁ G@E xf@ffffEEEEEf8C@to}@}ifMf98C@uf:C@fEEE@@M@@EE럐E@@M@@EE9Ew E9EE>uFOF8^kO J}^_[ÐUSEEE Eà .$pAEH@3[ÐEH@搐EH@֐EH@ƐEH@붐EH@릐EH@W떐EH@놐EH@sEH@ c[@@@@AA(A8AHAXA[U SWVEEE EEEEE@@AQ@EE@@@Q@}zEE%x@@M8G@LE x?}@3|1E@E%x@@؋M,G@t ^_[ËE@E@E3FEf8C@1@(8C@;uEEf:C@fEEE@@AQ@E@@FEf8C@tU@}P8C@;u݋Ef:C@fEEE AQ@8@@u @Q@8@@uE3^_[Ð}t%EE AQ@8@@u @Q@8@@tÃ^_[ÐUSWVEEE Ev6ExHu-uu @P u3^_[ }$^_[ÐuE@E@@AQ@EE%x@@MDG@tvE xtm}@EEEEf8C@tB}@}<8C@;uًEf:C@fEE AQ@8 E@@uE3E AQ@8 E@@Ã^_[ÐUjju @uL@ Ð} |j;E ~׋E 9Et+L@Eu /EL@u juW ÐUE PuÐUSWV3hXG@ME uE`G@j/u t oG@EPuV u P L@t ty DžpG@DžM  t!|L@^_[ÐPhPG@ ߐGwW&C  tL@ 밐USWVu} ] >:t C>u9]t /GC?u>t F^_[Ð3^_[ÐU,WVs } 3^_ÐjhtG@ |jk$PW跹 j$EPW $t W봐W}tjEPhDQ@ LQ@DQ@^_ÐUV( t6uƹ u?^ÐU=G@uhG@hG@螸G@Ð5G@U=G@t5G@LG@ÐUVu>:t > tF>u> u ^Ð>tF^ÐU=G@u hG@hG@G@ u3Ð5G@UVuhhPQ@÷ u3^ÐV跸ƉE;v:ME8 t/EyuEH@E@t} uр>t>:t5TU@V>t5XU@V>t>:kj EPVq Ej:V ;EE}| }`~aE\U@V>>: j EPV Ej:V;E}| }`~ aE`U@V">5hU@5lU@V>>:5pU@V>k5tU@V5XU@>,tF>u>tF5dU@TU@^Ð>TÐUWVu @G@9@u)P5@RG@ u@^_ÐPG@ t݋P5@5G@ܵ G@@ML8@D8@M 3^_ÐUSWVu3VS) t ^_[ÐG@ uG^_[ÐUWVu} >=u ^_ÐFG8Gt3^_ÐUVuV腴jjF P FFf F tf ^ÐU}u3jEhMj EEE}t7E9Ev )EE'E+EEEEEMujA hxU@ uuemjVE}| uj } }}}tEEPEEUjhxU@EÐÐÐD$Xpxh Z`P+␋T$D$;j t Zrzj bu@bVt$T$ :t#t:tt:tt :tu3^ËH^ÐUuó@P-E u3Ðuu虳U SWV}u U@E u3^_[u V{?tu W* u U@ CU@^_[ÐUSWVu} C;t8u;t^_[F~u3^_[ÐUSWVu ] G?t8u?u +E^_[ÐC;tېUSWVu}E} tE 0 |$~ 3^_[ÐEH@u, FEEH@u+t-u EFE u&}0t ~xt~XuEH@tH@t0EH@tW E7E;Qu(}0u"FH@t~xt~Xu EEH@t0EH@tW E7؋FEH@t/H@t0EH@tW E7E;|} tE 0}t^_[Ð+E뛐^_[Ð5@t$ t$  Ð;U@t3ÐV|$3O|$ L$Oϋt$ +D$^ÐUhPu =|hPu =}hPhH@误 hPhG@薯 3ÐU4SWVj u+j uj u ^_[Ðj/Vͯ uGjhH@3E |3Ff}tf}tf}tf}u(j EPWo uu%^_[ÐCj$EPu $tuVULVum u3^ÐEPu |fEf%f= uhH@E tžuE u$juN uu덐Eԃ8t tM9uhH@hU@mEԃ PhU@EPhU@ wfEf9EifEf%f= W tfEf9EEu U@^UVuv V6説^U(WVjuZ } 3^_ÐEPWn |2fEf%f=@u$j thF u%fEf%f=@t L@W두>3FF^_ø3ÐUWVuE~t~~ FEGFF9F|3FF~u+hv 6( F  uEF3^_Ð~~ ^_øQ ÐUVuVp;E tFju 6٫ F^ø3ÐV|$3O|$ ыt$ D$^UjjE0p u3ÐE@MA E@ø?DÐ0L$tÐ0PVNL$0PV:L$0+L$0L$0 L$0Ã詩T$ÐUu1@u3Uu@u3ÐEÐU=N@ uÐN@M xN@N@3ÐUV5N@Ny^ÐxN@Ny^Ð$<090@09//\*>4Y@@@@@@@@@@@ @ (@ 0@ 8@ @@ H@P@X@`@h@p@csh405075110134134.5150200300600120018002400480096001920019.23840038.4resetinitNot a terminal dialupplugboardBad flag -TERMunknownunknownTERM = (%s) TERM=%stputtputtputtsettsettsetTERM=%s-fmapstrmapstrmapstrtsettsettsetCannot open terminfo database Type %s unknownTerminfo error kbsosSHELLset noglob;export TERM;setenv TERM %s ; unset noglob;TERM=%s; %s Terminal type is %s EraseKillisset to%s %s control-%c unknownunknown/etc/ttytypesddialupspplugboardToo few args: Unexpected arg: Usage: tset [ - ] [ -hrsIQS ] [ -e[c] ] [ -E[c] ] [ -k[c] ] [-m [ident][test baudrate]:type] [type] %s%s %sunknown @ @dj@o@0o@po@TERMTERMINFO/usr/lib/terminfo/a//usr/lib/terminfo/.LINESCOLUMNS#$" !+,& !"#$       n ijk    l+,opcdefghijmq/.r0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ab&5   %)*./ 024361ABDEFGHIJKCN9;?TPM<>QRU@V87=XLOSY:WZ[]^_`abcd\' fe!"g*)hwstxvuz{|~}y+#-( !"#$%&'(,$- /usr/lib/terminfo is unaccessibleI don't know anything about your "%s" terminalcorrupted terminfo entryterminfo entry too longTERMINFO pathname for device exceeds 512 charactersmalloc returned NULLterminfo file for "%s" terminal is not readableSorry, . @@'@V@o@@@@#   $ "!    2  0bok p r3i4cj`% .-/ l43n5m+, 601279:O=SW;<@?ABCDEFGH    IJKLVMNTPQRU>8Z[\]^_`abcd1vwxPJOIQKRMHLg*)hhstuN!\~]y"}qAB&()C*Xeeg+,z{|DEFG@Zji-S[6/.'78TUVWXY9Yfdf#$:;<=>^?_5 !"#$%&'(abwamxsbxhpxenleognhckmhsindadbmirmsgroseslokxthzulxonnxonmc5ichtsnrrmcnpcndscrcccbcehlsxhpacrxmdaisyxvpasamcpixlpixcolsitlineslmxmcpbvtwslnlablhlwmawnumcolorspairsncvbufszspinvspinhmaddrmjumpmcsmlsnpinsorcorlorhiorvicpswidcscbtbelcrcsrtbccleareledhpacmdchcupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdch1dl1dslhdsmacsblinkboldsmcupsmdcdimsmirinvisprotrevsmsosmulechrmacssgr0rmcuprmdcrmirrmsormulflashfffslis1is2is3ifich1il1ipkbsktbckclrkctabkdch1kdl1kcud1krmirkelkedkf0kf1kf10kf2kf3kf4kf5kf6kf7kf8kf9khomekich1kil1kcub1kllknpkppkcuf1kindkrikhtskcuu1rmkxsmkxlf0lf1lf10lf2lf3lf4lf5lf6lf7lf8lf9rmmsmmnelpaddchdlcudichindnilcubcufrincuupfkeypflocpfxmc0mc4mc5reprs1rs2rs3rfrcvpascindrisgrhtswindhttsluchuiprogka1ka3kb2kc1kc3mc5prmpacscplnkcbtsmxonrmxonsmamrmamxoncxoffcenacssmlnrmlnkbegkcankclokcmdkcpykcrtkendkentkextkfndkhlpkmrkkmsgkmovknxtkopnkoptkprvkprtkrdokrefkrfrkrplkrstkresksavkspdkundkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkRDOkRPLkRITkRESkSAVkSPDkUNDrfikf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63el1mgcsmglsmgrflnsclkdclkrmclkcwinwingohupdialqdialtonepulsehookpausewaitu0u1u2u3u4u5u6u7u8u9opocinitcinitpscpsetfsetbcpilpichrcvrdefcswidmsdrfqsitmslmsmicmsnlqsnrmqsshmssubmssupmsumrwidmritmrlmrmicmrshmrsubmrsupmrummhpamcud1mcub1mcuf1mvpamcuu1pordermcudmcubmcufmcuuscssmgbsmgbpsmglpsmgrpsmgtsmgtpsbimscsdrbimrcsdsubcssupcsdocrzeromcsnmdispcsmpchrmpchsmscrmscpctrmscescscesa@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@$@)@,@2@5@9@<@?@C@H@K@N@Q@V@]@c@g@m@s@y@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@ @&@,@1@7@<@@@E@K@P@T@Y@^@b@h@m@s@x@}@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@ @&@*@.@2@8@=@A@F@L@Q@V@Z@^@c@g@k@o@s@w@{@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@"@&@*@.@3@7@<@@@E@K@Q@V@[@`@f@l@q@v@{@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@#@(@-@2@7@<@A@F@J@O@T@Y@^@c@h@m@r@w@|@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@ @%@*@/@4@9@>@C@H@M@R@W@\@a@f@k@p@u@z@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @ @@@@@@"@(@,@1@6@:@>@B@F@K@Q@W@\@`@f@k@q@v@|@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@"@'@-@3@8@>@C@I@O@U@Z@_@e@k@bwamxbxsxneognhckmhsindadbmimsosesxthzulxonx5iHCNRNPNDccuthlYAYBYCYDYEYFYGcoitlilmsgpbvtwsNllhlwmaMWCopaNCYaYbYcYdYeYfYgYhYiYjYkYlYmYnbtblcrcsctclcecdchCCcmdohovileCMvendllupvsdcdldshdasmbmdtidmmhimmkmpmrsousecaemeteedeiseuevbfffsi1isi3ificalipkbkakCktkDkLkdkMkEkSk0k1k;k2k3k4k5k6k7k8k9khkIkAklkHkNkPkrkFkRkTkukeksl0l1lal2l3l4l5l6l7l8l9mommnwpcDCDLDOICSFALLERISRUPpkplpxpspfporpr1r2r3rfrccvscsfsrsastwitatsuchuiPK1K3K2K4K5pOrPacpnkBSXRXSARAXNXFeALOLF@1@2@3@4@5@6@7@8@9@0%1%2%3%4%5%6%7%8%9%0&1&2&3&4&5&6&7&8&9&0*1*2*3*4*5*6*7*8*9*0#1#2#3#4%a%b%c%d%e%f%g%h%i%j!1!2!3RFF1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFrcbMCMLMRLfSCDKRCCWWGHUDIQDTOPUfhPAWAu0u1u2u3u4u5u6u7u8u9opocIcIpspSfSbZAZBZCZDZEZFZGZHZIZJZKZLZMZNZOZPZQZRZSZTZUZVZWZXZYZZZaZbZcZdZeZfZgZhZiZjZkZlZmZnZoZpZqZrZsZtZuZvZwZxZyS1S2S3S4S5S6S7S88"@;"@>"@A"@D"@G"@J"@M"@P"@S"@V"@Y"@\"@_"@b"@e"@h"@k"@n"@q"@t"@w"@z"@}"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@"@#@#@#@ #@ #@#@#@#@#@#@#@"#@%#@(#@+#@.#@1#@4#@7#@:#@=#@@#@C#@F#@I#@L#@O#@R#@U#@X#@[#@^#@a#@d#@g#@j#@m#@p#@s#@v#@y#@|#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@#@$@$@$@ $@ $@$@$@$@$@$@$@!$@$$@'$@*$@-$@0$@3$@6$@9$@<$@?$@B$@E$@H$@K$@N$@Q$@T$@W$@Z$@]$@`$@c$@f$@i$@l$@o$@r$@u$@x$@{$@~$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@%@%@%@ %@%@%@%@%@%@%@ %@#%@&%@)%@,%@/%@2%@5%@8%@;%@>%@A%@D%@G%@J%@M%@P%@S%@V%@Y%@\%@_%@b%@e%@h%@k%@n%@q%@t%@w%@z%@}%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@%@&@&@&@ &@ &@&@&@&@&@&@&@"&@%&@(&@+&@.&@1&@4&@7&@:&@=&@@&@C&@F&@I&@L&@O&@R&@U&@X&@[&@^&@a&@d&@g&@j&@m&@p&@s&@v&@y&@|&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@&@'@'@'@ '@ '@'@'@'@'@'@'@!'@$'@''@*'@-'@0'@3'@6'@9'@<'@?'@/etc/ttytyper %s: %s %d %s Error0@0@0@0@0@0@1@$1@81@L1@\1@p1@1@1@1@1@1@1@1@1@ 2@2@,2@@2@T2@h2@|2@2@2@2@2@2@2@2@3@$3@@3@T3@p3@3@3@3@3@3@4@4@84@T4@`4@l4@x4@4@4@4@4@4@4@5@(5@45@@5@T5@h5@x5@5@5@5@5@5@6@6@06@@6@L6@X6@l6@x6@6@6@6@6@6@6@ 7@47@\7@|7@7@7@7@ 8@$8@@8@`8@8@8@8@8@8@9@,9@L9@|9@9@9@9@9@:@$:@@:@L:@h:@:@:@:@:@:@;@;@0;@<;@H;@T;@`;@l;@x;@;@;@;@;@;@;@;@;@;@;@ <@<@(<@8<@H<@\<@h<@t<@<@<@<@<@<@<@<@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in path/etc/default/langLANG=?@english_us.ascii Q.(?@0?@english_us.ascii11?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~yn-$ +29AKT[dhlptx|%m/%d/%y%H:%M:%SAMPM%a %b %d %X %Z %YSundayMondayTuesdayWednesdayThursdayFridaySaturdaySunMonTueWedThuFriSatJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberJanFebMarAprMayJunJulAugSepOctNovDecstack overflow alphaupperlowerdigitalnumspaceprintpunctgraph cntrl  @ @ @ @/bin/shPATH:/bin:/usr/binsh/etc/utmp/etc/passwdrr  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~/etc/utmp/dev/ ((((( H b@b@|M@b@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_s... TIMEZONE!badtrk"bcheckrc#default(divvy)dkinit*emulator*emulator.ms+fdisk,fsck-fscmd.d4fsstat5group6haltsys6reboot7hdboot08hdboot19init:inittab;ioctl.syscon<masterboot=mkfs>mknod?mountall@passwdApipeBscsibadblkCsetmntDswapEttytypeFuadminGumountallbumountctermcapddevnmmnttabrchrootbmountutmp: # @(#) TIMEZONE 23.1 91/08/29 # # Copyright (C) 1988-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # #ident "@(#)adm:TIMEZONE 1.2" # Set timezone environment to default for this machine TZ=PST8PDT export TZ L+  C0-p@.textpp Cp .data@@0D@.bss05@05@-.fka000C".fka040@@LB.fka041L@L@.comment"0u.libRu@d,@4@0@@b@8@@@HX@@P\@ @X`@$@/@(@3@,@3@@ @@+@ÐET@RU RPWh@j3:L@ PAjU,fEu ue@uh@j[AEP5\@@u"5\@E 0hp@ j$AfEfNU@j5\@Z`V@@u"5\@E 0h@? j@h@@hD5`V@ hDU@hD5`V@ @thD5@hD5`V@ @uh@i*j{@=|V@EPhD5`V@f @uh@+*j=@f}u1EPhD5`V@. @uh@)j@=L@t=f}t6 t-F5@Ph@,(yuH@ fF5@hD5@hD5`V@ f=D5@!Ct fH5@hD5@5`V@hdV@7=L@=X@tRXU@+TU@ HU@+Eԃ=X@t5`V@Pj5T@[5`V@uj5T@=|V@t5`V@@u j>j5`V@P>h@ h<@h@h/@hh\U@* t h\U@'=\U@quT=|V@t$=H@u5`V@@u j3>=\V@tj5`V@&P >EEPh@h\U@s+ Et8tCh@=\V@tj5`V@5`V@hh'jF5@PhH5@'S"c!#h'jF5@PhH5@'\V@[UME }tlE E8-tÐEEet*ft-mstGvt6h@ Ð|V@ME }tE \@3ÐP@wL@ME }uE EE8GEdt:nt)qt ttBT@T@X@X@L@ME }E V@UI$EEEEffQfEEE@;EwÐU4VDžPhDuw @tEPhDu` @uh(@%%j7;fBthH@tj;Pu@uhp@Hj:MMJ#‰ uh@j:uaDž;vfu;u!h@jC:TU@TU@HXU@PU@^USWV3h@CF5@;ƉEHU@EEmEEHPuff+f5FU@Pff+f5FU@PGPh@ tù uCGf4H5@fqh0@^_[ÐU(SWVE4f+f5HU@ȸ4f+f5HU@f@E}EEHU@EfH5@fEEEETU@EE@;Ewzf}trE;TU@veuE+OFU@EܡTU@+E؋+uR+uPE+uRE+uP+uR+uPh@EEF5@9E=}u+ 0@yh0@j J 0@0@}^_[ÐUh @$ /@yh/@ uá/@/@ uÐUWV3ffJ5@fH5@FF5@;wh@@^_Uh< @h/@hP tP 1t2tqth\@믐Ð3øÐUh @&h/@hPh tP 1t2t93tLqt@hx@몋EXU@+TU@ HU@+M 3u u@uu ui搐U|P t}~ Ð3UuhD5`V@ @t Ef84t3ÐÐUSWV=`@tP uh@^_[ÐvE39k؋EV@E@V@NU@# ƉV@EF @@O;`@u u@t3^_[ÐU WV=d@u ud@@u/^_ÀtkV@h@hH @h/@hPC tPqtP | @@H;m @@HPh@rkV@ HU@+MV@ HU@+MM EEE m 3^_ÐUWV3F @@H;~ kV@| @@H;uh@^_Ðh@h@@31kV@~ V@V@V@PVhx@F @@H;h@n3^_ULSWVh@EPjEP;@uh@^_[E/nf}teEPEPdEPEP@@tB3F @@H;~)kE;V@u܍EPV@PƐjEPW u3^_[ÐU SWV5FU@=HU@TU@+++UXU@+++Uh @;uuh@hT @h/@hPG tPqu ^_[ÐPEPh,@Pth4@|9E79E|,9Eu E99Eu1E9}&uuhP@+h@5FU@9FPh@9E79E|,9Eu E99Eu5E9}*uuh@h@5FU@9FPh<@hh| @[h/@hP tPRqRPEPh@P2h@냐EMFU@E U5FU@;vhd@h@뫡TU@ HU@+M)TU@ HU@+M )3^_[ÐUWVu }h@Nh`@Ah/@hP tP8queuuuuS t,hD5@hD5`V@ @uh@ u\V@jhdV@&^_ÐU}t u} t u }t uUEEPEP@E@h @(yuh @yugE=L@t+ 0@yh0@j  0@0@}tuuuuuuuuÐUWVuhTj< @u ^_ÐE}𥥥feEEEPhTj @tjjj3^_ÐUuhTj jjAULSWVEEHU@JU@EԡXU@+TU@+EE+E EEUt@u |@E]uyE uh@j.,uu E=L@tEP@t h@WHU@TU@+E؃} uXU@+TU@+;EuE} j ~O /@yh/@/@/@qujjuuuEPW=L@uujEPur 9}u1XU@+TU@@ JU@%E)EuusE+E kdEEu_EE 9EuEd=L@u =P@t8FU@uE+RE+Ph @h0@Huuu ;Et]VE@jju" =L@EPy 0@h0@j }}tVjEPu> uuun ;Et=uuEV*E@cEmEG9}PYuu;Et뮐=P@t 0@Q 0@0@}u\V@}t(hD5@hD5`V@k @u hL@ 3^_[ÐUPSWVEEHU@JU@EԡXU@+TU@+EE+E EEUt@u |@E]uE uh@j(}t:uE uh@j(uuuE=L@tEP@t h@TU@ HU@+E؋u j ~Z /@yh/@D/@/@qu$j}tE3PuujEP=L@u}jEPu 9uu7XU@+TU@@ JU@%E)Eԃ}tuuE+E kdEEuEE 9EuEd=L@u =P@t8FU@uE+RE+Ph@ch0@uuuY ;EtpW&E@QE}t*}t$jEPu uuu =L@t EPj}E}jEPu uuu= ;EYjEPuY uuu ;Etuu EuuQ;Et-uuEW E@EmEjEPu uuu ;EtW E@EmEEF9u3Pu =L@u =P@t, 0@yh0@j w 0@0@}u\V@3^_[U VEEEF}EEh@ꐐEE ;E~3Ґu u ^ÐUV3uEEEE 9E}tڋϐ^ÐU V4f+f5HU@fff@ȸ4f+f5HU@ffPU@ HU@+f+fEfEfEfF5@f9EsEft%<5@y V FFE(jWF P uEE<5@Ee,@t5E} <5@VEP Mf]mY <5@VEP  <5@VEPw - <5@VEP_ EFFMxlE;sL@"3^_[e,@u}e,@e,@tCe,@t7W+؉EE9E|h}}}6EPZ]}t E]}lE@VWu_^3}t}u EmEEE܋ê<5@V}R4@;u EE tet E/}%EE ê<5@yV FFe,@g+^-Ue,@CE@EE}t }t]}lt}huE@fMfE@M <5@VS/ @u @5@E^_[ÐU SWVu} ] tE@3EEcu u<5@Ey u EH@E@t5su Ee,@u$[u EE8u tEMEK }u@5@ <5@& ~! <5@uuG @u @5@E9Eu3^_[ t ctE^_[ÐUSWVu} E>^uEFh}PW E]t-u_EM FS}u 3^_[Ð}-u2E]t'F;]}E+@PuPJ 붐EM FFE]u^_[ÐU SWVu3ۉ]]]F>e,@uǃ+t -uEFEEF~e,@u.uVEE uLF~e,@t>+]0} } mE}붐E}  kE ljECM뙐}u(+@^_[ÐEEEteucEE t +t-uEF>e,@t3}} kE ǃ0EF>e,@uރ}t+]]uSuuuO^_[ÐÐD$Xpxh Z`P+␋T$D$;j t Zrzj bu@bU8SWVu}6~L@"}8+@^_[Á}}L@"@+@^_[Ð t}+Ek p.@E?##@EE@M EEE؋E@؋EEp +ƉE~EE]3m}ueeEu %?ME%?E޸F+EEE?EEE؋??e?e?.E???3EEE*E u$]EEEm␐E} E |E)EMeeEEE؋E?e?e???+E P+Ek h-@E@EE@EEE܋E@E؋E@MMMMMMMMMMMEEEԋE@EЋE@MMM؋EMEE@ E]EEEE?E%?E%?E?#߿?#+E%k p.@E@EԋE@E؋EE܋E@EE@MMMMMMMMMMMEEEE@EE@MMM؋EMEE@ EE?E??EEԁ |ME+EE } EE}IEM E̋K EԉE u5 t1E̋Efs"L@"}0+@^_[Ð}u E^_[Ðuuu ^_[ÐU}tEH+@uEÍEPu uu P@}~B} EE=~TL@"EH+@s P+@ÐX+@Á}| EE=}L@"H+@uu u ÐUhPu\ =|hPu> =}hPhd,@ hPh`+@ֽ 3ÐUVu }u ^ÐF tF9FwF9Fu߃>uF~u V臼NFME^UEEf%Etf=Du]Ð)T$ÐUu1@u3Uu@u3ÐEÐU=,5@ uÐ,5@M 4@,5@3ÐUV5,5@Ny^Ð4@Ny^Ð 1. Print Current Bad Track Table 2. Scan Disk (You may choose Read-Only or Destructive later) 3. Add Entries to Current Bad Track Table by Cylinder/Head Number 4. Add Entries to Current Bad Track Table by Sector Number 5. Delete Entries Individually from Current Bad Track Table 6. Delete All Entries from Current Bad Track Table Enter your choice or q to quit: Usage: Badtrk - Display and Alter Bad Track Table Command line options: [ [-s] [qtnd] ][-e][-v] [-f "devicename" Defective Tracks: +--------------------------------------+ | Cylinder Head Sector Number(s) | +--------------------------------------+ +--------------------------------------+ Press to resume the scan or q to return to the main menu: Scanning in progress, type q to interrupt at any time WARNING: More than half of your UNIX partition is allocated for bad tracks. Type y to confirm, n to re-enter another value: You need to expand the area reserved for bad tracks. 1 bad track has been identified. %d bad tracks have been identified. Enter the number of bad tracks to allocate space for (or press to use the recommended value of %d): Beginning cylinder/head or q to quit: Ending cylinder/head or q to quit: This will destroy the present contents of the region you are scanning. Do you wish to continue? (y/n) Do you want this to be a destructive scan? (y/n) 1. Quick scan (approximately 7 megabytes/min) 2. Thorough scan (approximately 1 megabyte/min) Enter your choice or q to quit: 1. Scan entire UNIX partition 2. Scan a specified range of tracks 3. Scan a specified filesystem Enter your choice or q to quit: Enter the number in the lefthand column corresponding to the filesystem you wish to scan, or q to quit: Enter defective cylinder and head numbers. Numbers are in decimal and separated with a '/'. Terminate each entry with a . Terminate list of defects with a q. Enter in any order. Example: 20/3 When entering a cylinder and head number, numbers are in decimal and separated with a '/'. Example: 20/3 Enter defective sector numbers, in decimal. Terminate each entry with a . Terminate the list of defects with a q. Enter in any order. Example: 17 Enter the number in the lefthand column corresponding to the track you want to delete from the list of bad tracks. Terminate each entry with a . Terminate the list of valid tracks with a q. Enter in any order. Example: 1 WARNING: There is a bad spot on track %d/%d of the UNIX partition. UNIX will not work properly if a bad spot occurs anywhere between tracks %d/%d and %d/%d Attempting to copy any valid sectors within the bad track(s). You may see error messages from the disk driver here; these are normal and do not affect bad track aliasing. This device contains a valid division table. Additional (non-root) filesystems can be preserved across this reinstallation. If you wish to be able to preserve these file systems later, you must not change the current limit of the bad track table, which is %d bad tracks. Do you wish to leave it unchanged? (y/n) /dev/rhd0a4@%s: cannot stat %s %s: cannot open %s for ioctl could not get device parameterscould not get disk layout typecould not force new disk layout%dUnknown option bad option #1 could not get vdrive parametersNo virtual drive table: run /etc/fdisk could not stat deviceIllegal badtrk device. Badtrk can only check virtual drive partitions No active virtual drive: run /etc/fdisk %2d. | %4d %3d %7ld - %7ld | Press to continue: New blank table created Unknown option - try again Unknown option - try again No filesystems found Filesystem numbers must be between 0 and %d Invalid filesystem No filesystems found +----+----------------+-------------+---------------+ | # | Filesystem | First Block | Size (blocks) | | %-2d | %-15s| %10ld | %10ld | +----+----------------+-------------+---------------+ /devgetdevnames: open failed This partition contains tracks %d/%d to %d/%d. %d%*c%dIllegal value, try again! Track numbers must be between %d/%d and %d/%d to be in the UNIX partition Disk head values are between 0 and %d %d%*c%dIllegal value, try again! Track numbers must be between %d/%d and %d/%d to be in the UNIX partition Disk head values are between 0 and %d The ending cylinder must be greater than or equal to the starting cylinder Scan interrupted badtrk: rewrite of badtrk table failed badtrk: could not mallocDestructively scanning track %d/%-2d, %ld%% of scan completed badtrk: rewrite of badtrk table failed ?badtrk: could not mallocbadtrk: could not mallocScanning track %d/%-2d, %ld%% of scan completed Could not set badtrack table sizeYou must enter a number between 0 and %d, try again Could not set badtrack table size Do you want to update this device with the new table before scanning? (y/n) Do you want to update this device with the new table? (y/n) Do you want to attempt to salvage any valid data on the bad tracks? [may take a long time ] (y/n) badtrk: could not malloc Bad tracking successful badtrk: could not read sector %ld warning: track %d/%d not copied This partition contains sectors %ld to %ld. Defects: %ldIllegal value, try again! Only sector numbers between %ld and %ld are in this UNIX partition This partition contains tracks %d/%d to %d/%d. Defects: %d%*c%dIllegal value, try again! Track numbers must be between %d/%d and %d/%d to be in the UNIX partition Disk head values are between 0 and %d Defective Track Number: %dIllegal value, try again! There are %d tracks reserved so far Table Full Track %d/%d already considered bad Table Full Track already deleted from defect table Please answer y or n: %s: %s %d %s Error@@@@@(@4@P@d@x@@@@@@@@ @ @( @8 @H @X @l @ @ @ @ @ @ @ @!@!@$!@?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ ((((( H @:'i _;?U3R)E?98p)D5} [%/ -I /wb5,6)6d>n G79 85q&5 1Z$.H+jt'!]6$J !5w%^_KLza N } dP@fff&h&QG!+ A j<h"2S58C7{-_k2+/4 U# >D K) m5\W?YU }?^Fz !%ph]( ZJ(9H/9Y!,h`@h`@3@p`@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_s: # @(#) bcheckrc.sh 23.8 91/09/02 # # Copyright (C) 1988-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # Copyright (c) 1984, 1986, 1987, 1988 AT&T # THIS IS UNPUBLISHED PROPRIETARY SOURCE CODE OF AT&T # The copyright notice above does not evidence any # actual or intended publication of such source code. # ***** This file has those commands necessary to check the file # system, date, and anything else that should be done before mounting # the file systems. #! chmod +x ${file} [ -x /instscript ] && exec /instscript # for installation only if [ "$1" != "-a" ] then [ -x /etc/dumpsave ] && /etc/dumpsave fi rootfs=/dev/root /etc/fsstat ${rootfs} >/dev/null 2>&1 if [ $? -ne 0 ] then dofsck=yes fsckflags="-s -D -b" autoflag=-a # -a flag to fsck for autoboot if [ "$1" != "-a" ] then autoflag= echo " fsstat: root file system needs checking. OK to check the root file system (${rootfs})? (y/n) \c" while read reply [ "$reply" ] do case $reply in n) dofsck= break ;; y) break ;; *) echo "\n? (y/n) \c" ;; esac done fi [ "$dofsck" ] && /bin/su root -c "/etc/fsck -s -D -b ${autoflag} ${rootfs}" fi [ -f /instscript ] && rm -f /etc/inittab.inst /instscript # post-Upgrade cleanup trap "" 2 # put root into mount table /bin/su root -c "/etc/devnm /" | sed -n '/^\/./p' | grep -v swap | /etc/setmnt #...$format%mapkey&tape'taraboothd1# @(#) format135 23.2 91/08/29 # # Copyright (C) 1988-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # VERIFY=Y DEVICE=/dev/rfd0135ds18 # @(#) default 23.2 91/08/29 # # Copyright (C) 1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # tty01 tty02 tty03 tty04 tty05 tty06 tty07 tty08 tty09 tty10 tty11 tty12 # @(#) tape.dfl.src 23.1 91/08/29 # # Copyright (C) 1988-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # for cartridge tapes, use /dev/xct0 # for floppy tapes, use /dev/xctmini # device = /dev/xct0 # @(#) def135.src 23.2 91/08/29 # # Copyright (C) 1987-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # device block size tape # archive0=/dev/rfd048ds9 18 360 n archive1=/dev/rfd148ds9 18 360 n archive2=/dev/rfd096ds15 10 1200 n archive3=/dev/rfd196ds15 10 1200 n # archive4=/dev/rfd096ds9 18 720 n archive4=/dev/rfd0135ds9 18 720 n archive5=/dev/rfd1135ds9 18 720 n # archive5=/dev/rfd196ds9 18 720 n archive6=/dev/rfd0135ds18 18 1440 n archive7=/dev/rfd1135ds18 18 1440 n archive8=/dev/rct0 20 0 y archive9=/dev/rctmini 20 0 y # # The default device in the absence of a numeric or "-f device" argument archive=/dev/rfd0135ds18 18 1440 n L+ |K9op @.textpp|Kp .data @ @9L@.bssF@F@o.fka000C".fka040@@LB.fka041L@L@.comment"Ԇ.lib@>@@`@@h@ @p@$@A@(@TE@,@XE@@ @@<@4@0@X@8@ @ÐET @RU RPWh @j@L@ PIjU^4 th<@jIu u5@1: hjhjhjhjj5@I4@@uh`@,3j hA@s=@u=@u =@tBtP@t t%%h@2j$ =@t5@tPj =@t25@tPtP@P =@tejhF@tPn5@5@5@tP@ utP%5@S tPtP =\@tmEF@g=@u5@h@j jhF@ hF@tPtPE=\@u }utPtPhD54@ @uh@0j^ =X@tf=H@u=F@t j(&=X@t=F@tjᐐ&j)j U WV} uJ3F @;~_}GEGEHE9EtPuVh@S뽐} }GEGEHEPuu h @#^_ÐUuhD54@ @uÐEf84t Ð3UEf4uhD54@y @uh@/3UE MDÐUV@9@|hD@r^ÐiE F@9F@~u hx@A͐iE @F@@F@ uE M@TE M@+@BT3^U WVDžPhD54@s @uv=L@uPhD54@M @uh@v.j+,@50@EPhD54@ @uh@ .jk=@t =@u^Dž;vt;u%h@-j @H @0@,@%0@%0@),@,@ڍ5@@4.,@-0@0@ F@ HF@h@hD54@ uhD54@l @uh@,jEf84u@Dž8u,@0@NN;} @ @;=@t5,@50@95U@}5U@^_UWVEW=L@u=@u=@u =@t$hH@h @jAH@X@F9uE nE @Ph@5h @(j%A}=H@u=@u=@u =@t$h`@h @j@L@)=H@uhx@j@P@=H@u=@u=L@u =@t$h@gh @ZjW@E tt%@ | @;@}( @Ph@j?F@P=H@u=@u=L@u =@t$h@h @j?E | >@tQW$@ | @;@}ih@Z @Ph4@%h\@3 @Ph@h @j?E | >@tW$@4h@h@h @j>E |  >@tW#@1h@wh\@jh @]jZ>@=H@u=@u=L@u =@t$hx@h @j>E |?-tn >@tXW#@ | @H;@}( @HPh@j=E @u@9u~ E @^_U5@EE@ @@AEE@ @AE@Hf<@ff D@f f @ff Ph!5@' @u*=L@th@&j<Ð(@U EP5@@t5@ EP5@@t5@}} }~ 3P4<ÐU5@|EE@ @@AEE@ @AE@MAfEf 8@ff f D@f f @ff Pha5@& @u#=L@th@n%$@3ÐU@xXtK=$@uP@u hD@(%EE@@XE}|$@ÐUhr@@uht@$j:,@HPhF@=H@t~=P@t @X@=@t7ujy  E=\@ ,@HPhF@\j9 w=@tu_Ð=L@tfh@h@h@h(@hd@j(ÐUWV3h@Ei PF @;~8iEM 8EL8ED8uht@E 믐^_UEE=,@P}EE NE?=,@P~=,@}E@E0uE@EE:=P@tEÐ5,@h@uuh@ h@h@uh<@tE A@yhA@;A@A@ME < uȀ ^EƄP#EE9E} hp@`EÐU EEE-IE=P@h@yt3Ðh@uh8h@~ E A@yhA@EA@A@ME < uʋEƄP<E=8|E9E~uh@}p$EÐUVEEEE EEnE,@+EPE,@+E+E+EEF@HEF@9E~`E+F@@EPuuuXE+E=8|"E)EEE=| EEEEP@F@EHF@EI@uFI@}t5K@EH ,@HK@ K@,@+ES@,@HS@^UWVEEEE=,@ v ,@@E5,@h4@^h`@Qh@Duh@4 A@yhA@A@A@ME < uɋEƄPE uEE @H;E|E9Es+ @HPuh@ E3F9u~kiE쉇F@,@}EHF@@EF0P@0P@@0P58@h(@F@PsifǀH@F @;~i,@HF@F@Ґ^_ÐUEhF@hh@0h2@hF@-h4@hh@=H@u h@nh@jh@ E t{t또kF@Ã=H@t h@n3U=P@tÐh@uh4@h@5yt3UVE=L@EBh@iEF@P iEF@9F@uEEE @;E}tF@+F@E=5 ~jEP tRiEF@F@+EF@HF@h@F@PLh@iEH@P2^USWV3'i]CF@CHF@F @;^_[ÐUSWV33iE 8MDE D8M +9@MDF @;Ef4^_[ÐUWV5@ h@5@3^T@P PPhX@}i9Gu j-j-hx@}iw7h@ F @;~EEiPP}iVfYP@T5@*50@5,@h@ ^_ÐUfH@h@hF@M5@hH@:h@hI@(h@h K@K@9 K@t4}u.h@h$K@f6M@5@h%M@h@hS@h@hU@ÐUU@,@0@U@@0P@@0P58@h@hU@GÐU=P@t3h@hD@hl@h@ytÐU=P@u4h@h @hD @uhx @hÐU K@9K@uÐGttQ@9pQ@th @hxQ@S@9S@th @hS@c3ÐU=P@u>h @h @h0!@hp!@yt\@ÐUWVhF@nh!@jh!@ w.$ h!@jh!@ @tWh!@jh"@ @tWqڐh"@jh0"@ @cW벐h8"@jhX"@g @;W느h`"@jh"@? @jWh"@jh"@ @jΐ u  tZ9hF@hd@hh@hF@놐@hg^_Uh"@h"@h"@h#@h`#@h#@h#@=T@t h$@hD$@{U uhƅhA@hP E t PGPhx$@P !} uh@h|$@Pu: t >@th@븐+EÐU h$@ƅhA@hP E t PqP h@B!ÐuPq tPh$@j/PP th$@hF@hd@QPiEF@P!T@ÐU(WV3:E8ruxt@PFP tQ~ruuF P t8G @;~1iF@uFP u9} t^_Ð=X@t3^_Ðuh@oEPh@J@tE%;8@uE D@ @ M;ufEf%`f=`z댐UVhF@hd@ iEfdžH@5@H@PT@^ÐUhiEfH@t"h$@Ah%@4Ðj % hT%@Dž^Pj$ Ph%@ h%@P  u 9~@Ph%@Ph%@ih%@\ƅhA@hP E t P;Ph%@P Ph%@|;}Ph%@ǐ9uh&@phF@hd@ @;uhD&@iEH@PK;uhH&@iEH@Pj# }hP&@T@UhF@hd@r iEfǀH@T@ÐU E} u x&@&@Ph&@ƅhA@hP E t P EPh&@P h@XÐ}}h&@A Ð,@9E|HPh&@ܐT@hF@hd@w } uiEMF@iEMF@ÐU!=T@~>hd@@P% hF@hd@ @PhF@ Ðh&@{ÐUSWV3Eȋ 9HuHFiF@Eȋ 9H}h'@.Vh4'@ ^_[Ð3G};tiF@Eȋ 9HtߋE99X}EMI9HËM 9H|WVhX'@ hx'@닐3^_[ÐUWVE3iF@9}}}F @H;ًE^_ÐU4j3 E |:EEЋE9E!uj(EPuE uڋEÐÐU@SWVDž@Ef8r PP$EPP@>fEf%`f=`,u؋%;8@Ɗ @ @J#;@ @Hff+@ءD@#Nj#; @HM#EE PiEF@POiEfdžH@F@9F@_}UPZE } h'@iEH@P iEH@PujY } h'@h'@iEH@P jP,E |]jhP |hPu =t h'@hA@Kulufuh'@iEH@P!~u/iEjH@PH@P iEƀH@EuE ku'0 t=V3E0Pu0j두^_[ÐUWV3UiǬh@?tAWh@&ih@Ph@ h@2h@%F @;3iF@?Wh@iF@Ph@h@h@f8@ff D@f f @ff f ƘPhah@ @t?f<@ff D@f f @ff f ƘPh!h@ @u h'@j j h@ @tj j h@ @u h'@SF @;^_ÐUX}u4hH@F@+F@@Pj @uh(@ Ðh@(@hH@L t,hD(@hH@6 thL(@hH@  uhT(@hH@jjhH@jPjh\(@5@@uhd(@jh(@Yh(@@uh(@Bh(@1hh)@ t h)@(h&)@8@uh()@jT5@%@u h<)@}u jUWV3N9utHifH@u6F@t-H@PF@+F@@PV* @u hh)@gF @;^_ÐU$E= @uh)@- @u@u ÐCfEf EPhD54@ hA@h)@h)@N hA@h)@h)@7 EMPh)@EP E Ph)@EP h)@u th)@u u EE)@juEPh)@EP5@uh)@h)@h)@h)@,h)@&f}uh0*@名EPM;u=X@t}tl3U}uËE >@tuU A@yhA@lA@A@E@WtًE 0ӐE0^ÐUWV3wiEM 9 8EM L9L8EM f9f8E DPEDPiE  PE PmF @;t^_UVuVEHE< u^ A@yhA@A@A@E< t@tS=F@uF@y V FFE >@u F@VP@uF@댃%u GG؃%uWF@y VK FFE;P F@VP@D2*uDžGG DžDžk Ã0GG >@uރu DžlthuGG b[uPW C >@tDžl=@؃ntT=F@uKctF[tAF@y V FFE >@u F@VPn@Ã[t5ct0it ntbst!EPVS EPVPS tMhuEE@f F@frEE@ F@Y=F@VI^_[UxSWVu}EEEEEEE d=.$t;EE lEcEWS;P;P;P;=S;=====\;=====S;==h;F@yV< FF؃+t-t 0tBpEM}_F@yV FF؃03} i)}F@yV FFEt%F@y Vy FFE(jWF P uEEF@E >@t5E} F@VEPMf]mY F@VEPc F@VEPO- F@VEP7EFFMxlE;sL@"3^_[ >@u} >@ >@tC >@t7W+؉EE9E|h}}}6EPZ]}t E]}lE@VWu_^3}t}u EmEEE܋êF@V}RLF@;u EE tet E/}%EE êF@yV8 FF >@g+^-U >@CE@EE}t }t]}lt}huE@fMfE@M F@VS @u F@E^_[ÐU SWVu} ] tE@3EEcu uF@Ey u! EH@E@t5su E >@u$[u EE8u tEMEK }uF@ F@& ~! F@uu @u F@E9Eu3^_[ t ctE^_[ÐUSWVu} E>^uEFh}PWG E]t-u_EM FS}u 3^_[Ð}-u2E]t'F;]}E+@PuP 붐EM FFE]u^_[ÐU SWVu3ۉ]]]F> >@uǃ+t -uEFEEF~ >@u.uVEE uLF~ >@t>+]0} } mE}붐E}  kE ljECM뙐}u<@^_[ÐEEEteucEE t +t-uEF> >@t3}} kE ǃ0EF> >@uރ}t+]]uSuuu'^_[ÐÐ#83ÐU8SWVu}6~L@"}<@^_[Á}}L@"<@^_[Ð t}+Ek @@E?##@EE@M EEE؋E@؋EEp +ƉE~EE]3m}ueeEu %?ME%?E޸F+EEE?EEE؋??e?e?.E???3EEE*E u$]EEEm␐E} E |E)EMeeEEE؋E?e?e???+E P+Ek  ?@E@EE@EEE܋E@E؋E@MMMMMMMMMMMEEEԋE@EЋE@MMM؋EMEE@ E]EEEE?E%?E%?E?#߿?#+E%k @@E@EԋE@E؋EE܋E@EE@MMMMMMMMMMMEEEE@EE@MMM؋EMEE@ EE?E??EEԁ |ME+EE } EE}IEM E̋K EԉE u5 t1E̋Efs"L@"}<@^_[Ð}u E^_[Ðuuu ^_[ÐU}tE<@uEÍEPu u9 P@}~B} EE=~TL@"E<@s <@Ð<@Á}| EE=}L@"<@uu u Ð$ÐTÐD$Pt$Ð5 @t$ t$  Ð;顶t3ÐUhPu蠷 =|hPu肷 =}hPh>@3 hPh=@ 3ÐUVuv 菶V膶66^U(WVju } 3^_ÐEPWn |2fEf%f=@u$j苶 thxF u%fEf%f=@t L@W諵두>3FF^_ø(3ÐUWVuE~t~~ FEGFF9F|3FF~u+hv 6( F  uEF3^_Ð~~ ^_øQÐ3ÐUVu }u ^ÐF tF9FwF9Fu߃>uF~u VKNFME^øL$tÐUEEf%Etf=Du]ÐͳT$ÐUu1@u3Uu@u3ÐEÐU=F@ uÐF@M PF@F@3ÐUV5F@Ny^ÐPF@Ny^Ðusage: divvy [-m | -i[-n] | -D # | -P [#] | -C #1 #2 #3] [device] -m = mountable only -i = installation -n = non-interactive installation -D = delete division number # -P = print start block number and end block number of division number # or all if # is missing -C = create division number #1 starting at block number #2 and ending at block number #3 @@$@0@dev/ dev/r Illegal choice Incomplete command @'@'@/dev/rhd00EAFS/dev/cXXX/dev/bXXXOnly the Super User can run divvy. divvy: could not open temporary nodedivvy: could not read divvy tableNo valid divvy table for %s. divvy: could not write new division table%d %12ld %12ld %d %ld %ld divvy: could not write new divvy tableThe start block must be less than the end block. Filesystem number %d already exists. divvy: could not get virtual drive parametersdivvy: could not get drive parametersdivvy: no active fdisk partitiondivvy: could not read divvy table@Incompatible options Incompatible options -n requires -i Incompatible options Illegal argument. -D requires a digit in the 0 to %d range. Incompatible options The -C option requires three arguments, the first of which must be a digit in the 0 to %d range. The -C option requires three arguments, the first of which must be a digit in the 0 to %d range. The -C option requires three arguments, the second and third of which must be digits. The -C option requires three arguments, the second and third of which must be digits. Incompatible options Illegal argument. -p requires a digit in the 0 to %d range. Unknown option: '%c' divvy:could not make temporary character nodedivvy: could not make temporary block nodewarning: could not unlink temporary dev. node/cannot change directory to root No valid division table. Run divvy with either the -i flag if this device is to be initialized with a new root file system, or the -m flag if it is to be initialized with a number of mountable file systems. WHOLE DISKNOT USED There are %ld 1K blocks in the UNIX area. Between %ld and %ld 1K blocks should be reserved for the swap area. Please enter the swap-space allocation, or press to get the default allocation of %ld 1K blocks: Invalid swap space allocation Do you want a separate /u filesystem? (y/n) Enter allocation of 1K blocks for the /u file system (%ld to %ld)Invalid user file system allocation, %ld There are %ld blocks in the UNIX area. Please enter the number of file systems you want this area to be divided into, or press to get the default of %d file system(s) The valid number of file systems is between %d and %d d%d%c%c%c i[nstall] Install the division set-up shown r[eturn] Return to the previous menu e[xit] Exit without installing a division table Please enter your choice: ire The root file system is large enough that fsck will require a scratch division of %ld blocks to clean it. Would you like a scratch division to be allocated for you? (y/n) scratchscratchNON FS+---------------+---------------+--------+---+-------------+------------+ | Name | Type | New FS | # | First Block | Last Block | yesno| %-14s| %-14s| %-6s| %-2d|%13c|%12c| %13ld|%12ld| %ld 1K blocks for divisions, %ld 1K blocks reserved for the system rootswapNON FSurecoverNON FSd%d%c%c7allThis device contains a valid disk division table. Your additional (non-root) filesystems can be preserved across the reinstallation. Do you want to preserve your additional filesystems? (y/n) If you choose block-by-block control, do not change the bounds of any file system you wish to retain. Without block-by-block control, your original disk layout cannot and will not be modified. scratchrecover The layout of the filesystems and swap area is now prepared. Do you wish to make any manual adjustments to the sizes or names of the filesystems or swap area before they are created on the hard disk? (y/n) Enter your choice or q to quit: nctpseuqr which division? (0 through 7) 01234567 which division? (0 through 6) 0123456 which division? (0 through 6) 0123456 which division? (0 through 6) 0123456 which division? (0 through 6) 0123456 which division? (0 through 6) 0123456 n[ame] Name or rename a division. c[reate] Create a new file system on this division. t[ype] Select or change filesystem type on new filesystems. p[revent] Prevent a new file system from being created on this division. s[tart] Start a division on a different block. e[nd] End a division on a different block. u[ndo] Undo the last change. r[estore] Restore the original division table. %2s what do you want to call it? Another device is already called %s Division names cannot contain '/' chars. Error: division already in use. Filesystem type may only be selected for new filesystems. Choose from the following filesystem types: %d. %s DOS %d. AFS %d. EAFS Please enter your choice: %dError: enter a number (1 - %d) Error: enter a number (1 - %d) Error: creation of DOS filesystems not supported. AFSEAFSError: filesystem type not changed. endingstarting %s block number? %ld All blocks are positive numbers There are only %ld blocks on the disk No changes to undo. Starting block greater than ending block on division %d: please correct. Divisions %d and %d overlap, please correct. /dev/dsk//dev/NON FSNON FSS51Kcmd: cannot read superblock AFSdivvy: could not make nodedivvy: could not chown devicesfile system construction unsuccessful AFSES51KEAFSS51K/mnt/divvy: mount on /mnt failedCannot set up new /dev directory on new device /mntdivvy: chdir to /mnt failedCannot set up new /dev directory on new device devcannot create /dev directory/no root directoryWarning: umount failed: /mnt still mounted warning: filesystem %d not made Making filesystems w/dev/nullw/dev/null%d%ldEAFSES51K-E1-f-ymkfs/etc/mkfsdivvy: /etc/mkfs missing, could not make filesystem. divvy: forkPlease type 'y' or 'n': Press to continue Cannot stat device "%s" stat"%s" not a special device file Division %d is greater than 2 Gigabytes: please correct. *** WARNING: the root filesystem size of %d 1K blocks *** causes it to extend beyond 1024 cylinders by %d 1K *** blocks, which may be unbootable. *** WARNING: the default root filesystem size of %d 1K blocks *** causes it to extend beyond 1024 cylinders by %d 1K *** blocks, which may be unbootable. *** The root filesystem has been reduced to %d blocks *** and the /u filesystem extended to %d blocks. *** and the swap area extended to %d blocks. *** Reducing root to %d 1K blocks may make it too small. *** You are advised to use fdisk to ensure that the unix *** partition starts at least %d 1K blocks before the *** 1024th cylinder. %s: %s %d %s Errorx0@0@0@0@0@0@0@0@ 1@ 1@01@D1@X1@l1@1@1@1@1@1@1@1@1@2@2@(2@<2@P2@`2@p2@2@2@2@2@2@2@2@3@(3@D3@`3@p3@3@3@3@3@3@ 4@(4@44@@4@L4@d4@|4@4@4@4@4@4@4@5@5@(5@<5@L5@d5@5@5@5@5@5@5@6@6@ 6@,6@@6@L6@X6@l6@6@6@6@6@6@7@07@P7@7@7@7@7@7@8@48@T8@t8@8@8@8@8@9@ 9@P9@h9@9@9@9@9@9@:@ :@<:@T:@x:@:@:@:@:@:@;@;@;@(;@4;@@;@L;@X;@d;@p;@|;@;@;@;@;@;@;@;@;@;@ <@<@0<@<<@H<@T<@`<@t<@<@<@<@<@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in pathGG  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ ((((( H @:'i _;?U3R)E?98p)D5} [%/ -I /wb5,6)6d>n G79 85q&5 1Z$.H+jt'!]6$J !5w%^_KLza N } dP@fff&h&QG!+ A j<h"2S58C7{-_k2+/4 U# >D K) m5\W?YU }?^Fz !%ph]( ZJ(9H/9Y!,@@TE@@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_s: # @(#) dkinit.sh 25.4 93/02/24 # # Copyright (C) 1986-1993 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # DKINIT - SCO UNIX System V hard disk initialization # with non-standard disk support. # dkconf=/usr/lib/mkdev/perms/DKINIT Getdfl() { read prm1 prm2 prm3 prm4 prm5 prm6 prm7 prm8 < /tmp/dkinit$$ } Showdfl() { echo " Disk Parameters Values --------------- ------ 1. Cylinders $prm1 2. Heads $prm2 3. Write Reduce $prm3 4. Write Precomp $prm4 5. Ecc $prm5 6. Control $prm6 7. Landing Zone $prm7 8. Sectors/track $prm8" } usage() { echo "USAGE: dkinit [/dev/rhd00 | drive-number (0|1) controller-number (0-6) controller-type (W|E|I)] where controller-type W = ST506 / ESDI E = OMTI I = IDA" exit 1 } # Initialize variables modified= root= controller= drive= type= case $# in 1) if [ "$1" = "/dev/rhd00" ] then root=yes else usage fi ;; 3) drive=$1 controller=$2 type=$3 ;; *) usage ;; esac # determine the disk number from DKINIT if [ -f $dkconf -a "$root" != "yes" -a "$controller.$drive" != "0.0" ] then drive0=`grep "^$type $controller 0" $dkconf | awk '{print $4}' ` dn=`grep "^$type $controller $drive" $dkconf | awk '{print $4}' ` [ ! "$dn" ] && { echo "Drive $drive on Controller $type $controller is \ not configured" exit 1 } [ "$controller" -eq 0 ] && { # /usr/lib/mkdev/perms/DKINIT does not exist during a root # install so the entry for the first disk on the primary # controller is not listed. We have the second disk on that # controller, so assume that the 1st disk exists, and is the # root disk. drive0=0 } [ ! "$drive0" ] && { echo "Controller $type $controller is not configured" exit 1 } else # /usr/lib/mkdev/perms/DKINIT does not exist at install time # if drive==0 and controller==0 assume root install if [ "$drive" -eq 0 -a "$controller" -eq 0 ] then dn=0 drive0=0 dparam -w else echo "dkinit: Cannot open $dkconf" exit 1 fi fi dparam /dev/rdsk/${dn}s0 > /tmp/dkinit$$ Getdfl while echo "\nHard Disk Drive $dn Configuration 1. Display current disk parameters 2. Modify current disk parameters 3. Select default disk parameters Enter your choice or q to quit: \c" do read ans case "$ans" in 1) Showdfl ;; 2) Showdfl while echo "\nEnter a parameter to modify or q to return to the main menu: \c" do read y case "$y" in [1-8]) while echo "\nEnter the new value or to use the existing value: \c" do read z case "$z" in [0-9]*) eval prm$y=$z modified=1 break ;; "") break ;; *) echo "Please enter a numeric value.\n" ;; esac done ;; [qQ]) break ;; *) echo "Please enter a choice, 1-8 or q.\n" ;; esac done ;; 3) [ $modified ] && { Getdfl Showdfl } ;; [qQ]) [ $modified ] && { dparam -w /dev/rdsk/${drive0}s0 dparam /dev/rdsk/${dn}s0 $prm1 $prm2 $prm3 $prm4 $prm5 $prm6 $prm7 $prm8 } break ;; *) echo "\nPlease enter a choice, 1 2 3 or q.\n" ;; esac done rm -f /tmp/dkinit* MSEM87gfw...GW ˀ =tÀ Ë5;5r 5Ë5;5 w 5Su8u1u+u$uuuu u@u[Xϐ w w w w w w w wwwwwQwwww z 0 > L t a m 4 C R I6@@d 4   J!!!!!!! -O-+A,' ;Z(C.) ( ! !! ! !!  1    1  / / /   1 c; 1 V ; ; 1 e / / / V e 1 V j; 1 V N ] % N / / / ; ; 1 e @B@@?j0SeB׳#,k d35h!Kx\); yr{Z>\i7M, fˑX^ y cfψp9F ˑX^2[ɤPK+RJeBPUK$C8V ObmQP;$m[ PK$CtT=_Jow{8 ]{~ -wWqO15^KzӲ( /Ċ vp>[`3l_ PPf/ffpf~rfvfxf|f=mXWVUTSRQPf@u f'fE,}4f/ff&f p&=rf&f |R(s=fE(]8@t .$B.$?KEIӊ GfOf.fE(fE 3ۊG$<uDEQtY3ۊG$DEQtYGf`3ۊG$DEQtY/t&tGft7}4f/ff ffv5x݃t .]S[ff5 =dT}43f/ffft .]erT5dt=dtt,.]5;5 w M5 5R.]H-f 953ҊՀR+;= G}43f/ffXYZ[]^_ff Њ%€? Њ%fuX‹N3ufE Ћ‹fG03ufE Ћ‹fGGf7GGƋUfE . f2ff3ffPfك.$]"fك.$]25;5 w 5 5fك.$]Bfك.$]RfuJftcfffu;ft2fË5 5fff<3ffE,ftfuS0fu.$]b.$].$]fuPfuAff3ftf>f @f)f#f3һRf3҇f3һf3һG F f2w 2V fOfF.#dW f f J2(w f f f =d... Ë=d;t t2xmƋ߹fwqjf+| ffff=C~?URfwf2yfffOf_ff xffffURQ2ffffffffff3ff f|"f tffffff3fwtkr-f|4t5t6tqtАU ME }E E8-tÐEE8fuME }tE @3ÐEatct8dt;pt>ttA믐#@@ME E8pu%q#@#@#@EEƒ}^}t@@uE 0h@,ME ME 0#@ME E8c}E 0f#@ E 8-u #@ME E 01#@ E 8-u #@=#@M=#@^;}t=#@uh@7ÐUE=#@t =#@t x=#@tVd=#@t^=#@u=#@u|=#@u #@=#@u#@ @++#@@#@5@EEUEM 9u3ÐEM 9}ÐÐUWVDžlEEBkE!@t-l!@G!@!@HplE}~ @9lr ^_Ðlu##@#@ @+#@3^_Ãl~5h,jlEPh,jlpPEl9Eu/#@M+l @+EE9E~ EEEE}uEDHEE9E~ EEEE}~4l9E})uF+lHEE9E~ EEEEEl9EU}u#@El@#@EU#@ @+HEr@u6h@@ Ðjc5#@5#@ @t 3ÐU#@ @+HEs3=@thL@\=@t ÐEE @9Ew kE!@u @9Ev=@tbh|@뗐=@uu5#@5#@ @t3Ð+ Eqt:tPo Eqt$tjcPu @t 뱐ÐU E=@t>=!@uh@O Ð Equ+3Ð#@Ek!@uh@ 뿐kE!@Exct2=@t)hX@h@ @tE=@t}t j@tu eÐU=@t==!@uh@j Ð Equ+3Ð#@Ek!@uh@'EkEǀ!@E @9EvkEǀ!@뜐UVEEE @9Ew1kE3!@!@!@!@!@!@ÐE!@!@cEE @5 @ @H+MA Ex u@ E #@+J  @+AHE #@ @+ʉHE@E@=@tRJa 3^E @9EEkE!@t=@j @3^Uh4@u u ch<@u u hD@u u hL@u~ thT@uj uÐhX@uN uÐh`@u2 uÐhh@u uÐhl@u uÐÐUEt?t t-uFt@Dx@Ð@Ð@Ð@Ð@Ðt˃tփct=tҸ@ÐUEE!@B@EEpiEuPEppp uh@EE @9EwExt8u@3U5@h@EE!@lh@gEpPh@KEp h @8Eph@%Eph@EE @9Ew3Extuh@E8ch@^h@#@@Ph$@ @@PhD@ÐUSWVj5@v#@@u5@ht@`j E @h @hD5#@ @uh@'j E @h @hD5#@ @uh@j !@G E@M G#@H#@GE!GG GE @9EvӋEf8B!@Ed~tQFGFMI+G EXFFH+HG+G @GFGFGG)#@Eƃ @9Ev^_[ÐU SWVE @} tE E #@A;vh@^_[ÐEE HEG @;r8k!@~tF 9ErF9Ev F 9Es9Erh@뗐=@t #@MI+;Es hX@-=@EXE+ uE + EXE+ÉEEXE +EG @;rBk!@~tEE;F v؋E9F vЋF +EEEXE++ÉEh@suh@Yuh@Ih,@<!@~uE EE@MImE=@=MI+MI+@EEXE+EhT@h@h@h@h@uh@tEF EFE FEFFF3^_[UEE!@ EE @9EwE8uxcu3h8@UWVE @ @!@ @ @#@EFG EE@mF~GGEE@mFG)#@E @9EwfGfFff~G릐f @Bh @h D5#@ @uhh@^_Ð3^_ÐUVuF#@~$t4,F FFF$FF(F F,FF0FF4F~$uFFF FFF^ÐUh@t t@yht@BÐx@x@ÐUht@hh@ E t P=@yt =@Yu3ÐÐUVh@ht@hh@0 E t Ph=@qu @^Ðh@E u35 @ @H+E uEuh@i}}h@V^ÐE^ÐUh$@1ht@hh@u E t P=@qu @h@E #@A;vhX@Ðh@ÐUhh@ht@hh@ E t P!=@qu @h@oE ~ @9Ew kE!@uh@닋EÐUh@ht@hh@a E t P=@qu @h@E ~ @9Ew kE!@uh@닋EÐU}t<@L@Ph@4ÐUh @ljÐUVuVHE< u^ t@yht@ x@x@E< t to continue Enter starting track number, or 'q' to return: note: starting at track %d to leave room for masterboot Invalid entry Enter partition size in tracks, or 'q' to return: Invalid entry Enter partition number you want to make active, or `q' to return: Invalid partition number, try again: Enter partition number you want to delete, or 'q' to return: Invalid partition number, try again: on your diskin the UNIX partition ((((( H +@+@4@+@@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sLB+ $#p@.textpp$p .data@@#%@.bss(@(@.fka000C".fka040@@LB.fka041L@L@.comment"H.libH@H"@4@0@<@8@@@2@@6@ @:@$@L#@(@ '@,@'@@ @@=@@PR^_[USWVhH@hL@'h\@52@hl@hl#@jhP # j Pw E 8)jh@52@h@hl#@!jYPE  MQ>E 8'h@52@h@hl#@j^_[USWVh(@jjhh(@hh,@5(@0;huh(@ 5(@ ,@_u52@h@hl#@5(@c '"52@h@hl#@ ^_[U SWVEPu&u52@h8@hl#@uG fEf%`f=`QLfEf%@f=@0+fEf% f=  ^_[USWVu @PUMu E0^_[USWV52@uhP@h`@uju2 ^_[USWVuwuE0u52@hl@hl#@@=+u< E E^_[ÐUSWVEEME h@E 0@E 0E EPfEE ME 0E EPEEHE 0>- VE EPEoE 0E EPEKEMEME^_[U@SWVupE} Quj(EPu@ ,EPEPj EPu ^^_[U4SWVjẼEREEЋE9E-uj(EPuEE^_[ÐU}u3Ðhu MA |jjEp }$Ef@tu h@hl#@q 말ÐUWVjE u#fEth@hl#@23^_ÐEȋЋ3~ zy8ExEMHE^_Uh@h@uÐUh@h@uÐUtuZE u3Et"uu uu אEtVh@u nE ufEtu h@hl#@O uhu EEEPu  }/h@u E uHfETu h@뇐h.@u E ufE%u h0@UjLE u_urufEhT@h@@u \E ufEu hD@ujjHu>tUu3E@ uufE;u ht@hl#@ !E@HE8uȋUQE@MHHEMHjL E JuuRfEhd@hl#@Wu#Eȋ HU}t Exu3ÐE@EE | HEE | HE} t}|E@Puu E)E}t#}|E@PE Pu E)E}t EMfI@f} E MIDh@uV h@E P: } }EHE} }EHE} t#}~E@PEPu E)E}t#}~E@PE(Pu E)EE@HE @EȋIH EMHÐUuÐUV}tCFHEE0vEME0 u܃x~ puI^ÐUV@=L@| @9L@} L@4@}tE8tPh@hl#@ 5L@V@u @@Phl#@^ÐUWVj*ju & 3U}#E kME 8GEI"@u؋E8u3^_Ð t t5$EE8_u F}/3뼐Ex.t ^_ÐFܐEE8.t䐐^_UWV3%kE<8ujE PEP F|^_ÐUjh@j u Pu j jh@j E.$E @u bPu j j"h$@jz jhH@jb jh\@ՐjhX@jF jhp@j5 j h\@jhp@j jhh@륐jh|@낐jh@sj h@g+$\xjh@jU4h@ud uEp@uu t ÐE8txt x>u E t1EPub tu j5EPuE8txt xh@sE t0EPu tu jEPuE8txt xh\@ t$E8uxu xu jEhp@E EPui tu j<}t}t}t܋E8tEPu tvExtEPEP tFExtEPEPm tEPuOE}jP}u u j]E8t xtxu EPhp@TEPu3ÐU=@|5@}t juV@ } Ð3Ujj5@ EuEhh0@5@ E ~3E0@EEE8 t EM}u}u2}0@u3Ðju5@ }tEEÐEE+E@Euuu tME@EwUVEPkEH|@u , t3^h@EPE-h@EPj jkEDPEPe E}|h@EP9 kEH@EP# jEP|@u)}tkEH|@j6Q@^jEP| |kEHM8@t(kEH|@j|u|kEH@E|K}tkEH|@j^kEHƀ@jEPVK h@kEH@P" jEPkEH@P h@kEH@P jEPkEH@P HE@^ÐUWVEE1@} }3g1@^_Ðh@h1@q kH@Ph1@[ kH@t!@P@P: tEFkH|@u}t@^_Ð3kHE9x@u @^_ÐFkH|@u3^_Ð}hu h1@ 2@=1@/uEE1@E1@3juV E tF}u$}t*EEj/PE tEkH|@uE ^_Ð3FkH|@DkHM9x@uju VJ ^_ÐUV}|+EERkHl@^Ð@^U}uuj t3ÐU@ÐUjju uUjuu uÐUSEEEEEEM8E 8EPEPEP EEPEPE P EE$@EE$@E:t E+[Ð}uEE%@M M%@+E}iM`3[ÐEM8u3EPEPEPG EE M8u3EPEPE P E9Et E+E[Ð}tE[UhD=h`Ð#L3ÐVt$T$ :t#t:tt:tt :tu3^ËH^ÐTÐ;t3ÐUSWVu@ u 3^_[Ð;tsV t^_[ÐUWVu} G8Gu F~=u^_À>u=t3^_ÐUhPut =|hPuV =}hPhH"@ hPhD!@ 3ÐWVt$ |$;t1L$AIt)u*t!ItutItut Itu u3^_W+^_ËV|$3O|$ ыt$ D$^ø@L$tÐ-T$ÐUu1@u3Uu@u3ÐEÐU=(@ uÐ(@M (@(@3ÐUV5(@Ny^Ð(@Ny^Ð%s: cannot determine filesystem type of %s %s: cannot stat filesystem %s %s: didn't exec! errno = %d %s: didn't fork the fsck process %s: there is no %s of type %s r/etc/checklist/etc/checklist%s: cannot open or read %s /etc/checklist%s: %s contains more than %d entries. /etc/checklist%s: No devices specified in %s %s: '%s' is not a mounted filesystem %s: could not read mount table %s: couldn't stat '%s' /etc/fscmd.d%s/%s/%s%s: couldn't get dev for %s -tCannot lock temp file %s Out of memory /etc/.mnt.lock/etc/mnttab/usr/nserve/.rmnt.lock/usr/nserve/rmnttabwCannot create %s wCannot create %s rCannot open %s rCannot open %s Out of memory Out of memory Cannot read %s nowherenothing%s: %s %d %s Error @ @$ @@ @P @h @t @ @ @ @ @ @ @ @ @$ @< @H @T @h @x @ @ @ @ @ @ @ @ @ @0 @H @X @d @| @ @ @ @ @ @@@4@T@p@@@@@@@@@(@@@T@d@|@@@@@@@@@4@H@`@p@@@@@@@@@@@$@@@`@x@@@@(@P@\@x@@@@@ @ @@@X@t@@@@@ @0@H@l@@@@@@@4@L@`@p@@@@@@@@@@@@@ @,@8@D@P@\@x@@@@@@@@@@ @@$@0@<@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in path/etc/default/langLANG=@english_us.ascii#@@english_us.ascii @@english_us.ascii@@english_us.asciiX@@english_us.ascii@@english_us.ascii(d@english_us.asciiLC_CTYPEctypeLC_NUMERICnumericLC_TIMEtimeLC_COLLATEcollateLC_MESSAGESmessagesLC_MONETARYcurrencylibc: setlocale: : LANG environment variable syntax errorunable to open no line in syntax error in cannot open locale filecorrupt locale fileunknown error CLANG/usr/lib/lang//_./      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~yn-$ +29AKT[dhlptx|%m/%d/%y%H:%M:%SAMPM%a %b %d %X %Z %YSundayMondayTuesdayWednesdayThursdayFridaySaturdaySunMonTueWedThuFriSatJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberJanFebMarAprMayJunJulAugSepOctNovDec @ @  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ ((((( H :@:@ '@:@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_s-....S51K0AFS1EAFS..-../fsck2fsstat3mkfsLj+ w$8+p@ @.textppwp .data@ @@ @$@y@.bss.@.@8+.fka000C".fka040@@LB.fka041L@L@.comment".lib:@'@@ @@@%@4@0@PY@8@A @@XO@@`S@ @hW@$@(@(@,@,@,@ÐETA @RU RPWh@ @jWL@ PLvjUxSWVE '@t\ @jh(@jh(@sEEFd4@E G8-t M}\ @Ph @E 4h|:@GM}/E ;- CStKCNBE P2`4@두E P2a4@rb4@c4@]c4@b4@Iq4@<f4@0g4@$S @5` @Ml4@h4@P @Q @R @E PL @ | HL @5L @h:@\ @Ph @Bj$twD?EnFYNE @P\ @Ph @# .f)TYab말nqs1tyor=b4@t=`4@t\ @Ph @=b4@t=f4@t\ @Ph @e=`4@t=a4@t`4@=a4@tb4@=S @h @_ th4 @hH @h(@K chp @B_PpEh| @P t(h @u th @uk u c4@b4@}h @5X @C u5X @\ @Ph @e V/EjEE@PEE]E MEE9E|VemGEE;E~NjEP@PlMUEPEEM4Ej2EPV1. @uEMEE EEV7E+EEE7@G@;@Ph:@\ @Ph @h(@rD~th @h(@ZDh @=2@G@tth:@\ @Ph @h(@$D:@f;@f;@f;@f9;@w*jjy) t% tjVs t=r4@= ?@t"4@ P54@5x4@h\G@@ ?@=DG@4@ P5x4@9DG@EE8u4@ +i x4@E'EƀE@EM EMm x4@9Esr4@=h4@+h:@\ @Ph@ @h(@Bf;@4@4@4@:@jj'( t t5h:@\ @Phd @ h:@\ @Ph @h(@>Bh @$ t # u h @ufN@ ?@jj'4@h:@\ @Ph @h(@Af;@Mh:@\ @Ph @h(@Ah @_$ uh @{f;@f;@f9;@jj&u:@LH4@ @f;@fEf;@f$?@" t>F4C@f ;@jVf ;@f;@f tjjr&tf$?@f;@8u'4@4@4@4@?:@fEf;@h:@\ @Ph @h(@t@:@!f;@%jj' tJPEf;@f;@f9;@jj%tt~Ő2@jhL @멐9\4@vf;@f9u! t˃~t7 ujh< @\jhD @렐jhT @떐jh\ @느;@+lG@ F@;h:@\ @Phd @h(@@?=f4@t-h @!uf;@f+lG@fF@@G@h(?@h\G@'f=HE@u @ @Ph:@\ @Ph @h(@>=`4@u=a4@t)=e4@u h @h(@Y>u4@h @h(@9>=4@t5HG@54@5|4@+ cEOuj &EETG@Pj%EhPEP* EƀETG@9E|3:@:@*=:@t%5:@h:@\ @Ph @h(@r==:@t%5:@h:@\ @Ph@h(@D=;@)XG@hG@=u4@G@+|G@EhG@XG@;Et=E+hG@+XG@Ph:@\ @Ph$@h(@<u4@XG@9F@t~h:@\ @Ph@@h(@<=f4@t3XG@F@@G@h:@\ @Phh@h(@f<$hx@uXG@F@@G@=u4@tth:@\ @Ph|@h(@<=f4@t4=`4@u+u4@h:@\ @Ph@h(@;h@ uu4@=u4@t|=L @t=L @t ff3fHE@f=HE@u@@Ph:@\ @Ph@h(@^;;@XG@)hG@a+F@XG@h(?@h\G@$h;@h\G@#h8C@h\G@#=dG@t p4@ p4@=i4@t=4G@r^us4@4G@F@=8&|=f4@ux=dG@u =e4@th@QtTp4@R=b4@t#h:@\ @Ph@h(@S:͐h:@\ @Ph @h(@0:p4@XG@PhG@P5lG@h:@\ @PhD@h(@9=dG@u =p4@t6hF@=p4@u =s4@t8&|+F@4G@@G@$^=dG@-=i4@=S @t/=l4@t&5l4@v5l4@Yl4@h:@\ @Phh@h(@19=q4@t}=s4@u8jjj_ u&h@h(@8h(@^_[Ðh@h(@8h(@j[jjj_ ^_[h:@\ @Ph@h(@8h:@\ @Ph@h(@h8^_[UHSWVu} ff%fEf=`t f= tf=Pu ^_[Ðj F PEPP t tt:@E]E#E㐐E;v.;tE;P3UEĨtփtыE^_[ÐEE}W;tWu3 EĨtuϐUSWVu }uDž9}u&:@uبu^_[ÐDž#|G@9E| G@9E| ^_[EDžuP tN!j7t}uE;v?t ~uV7 ͸^_[ÐUSWVuEE95|G@95G@ ^_[Vh(?@A t0?@0C@߃EG;vރ}t ;tEΐ} G;uC;.u>{u8Ef;@f9t;@Ph:@\ @Ph0@h(@5릐G;u=;.u8{.u2{u,Ef?S;@Ph:@\ @PhT@믐;/X;uf?t G;BEC'} }}|;@Ph:@\ @Phx@h(@4Vh:@\ @Ph@h(@4 h4@h:@\ @Ph@h(@4^_[Ð}tj;@Ph:@\ @Ph@h(@v4Vh:@\ @Ph@h(@V4. h4@h:@\ @Ph@y^_[ÐUWVu95|G@95G@yVh@:@=:@ |P;@Ph:@\ @Ph@h(@3h @ u h)@ ^_Ð^_ÐjV Vh,@2:@=:@ |D;@Ph:@\ @Ph0@h(@<3hP@ uhY@o=2@XO@r@h:@\ @Ph\@h(@2hx@ 5h@#G@9=2@v97u2@2@09=2@w82@2@ 2@ 2@2@0hG@jV4C@^_UWVu95|G@95G@ ^_ÿG@9=2@vA97uVh@-2@2@2@0=2@G@u ^_Ð^_ÐUSWVuff;@f u ^_[Ã=d @u 4@4@d @4@+4@EFP;E~qh:@\ @Ph@h(@N1h:@\ @Ph@h(@/1h4@h:@\ @Ph@h(@ 1WjXF;v4@4@G u 4@4@3ہ=H @!~uf=;@ud @f;@f9;@w f=;@suh@h@>ء4@4@ h@؃tE tjff%f=@u Pjj ttt t}jj;jjj'Qf ^_[ÐUWVu95|G@95G@ ^_jV t(G@9=2@v97u-2@2@^_jV hG@UVu95|G@95G@eu4@:@=:@ |Gh:@\ @Ph @h(@.h4@ u h=@1^Ð^jV  tQu4@:@=:@|Ih:@\ @Ph@@h(@x.hh@3 uhq@뇐XG@jV^ÐU;@Puu h:@\ @Pht@h(@.jjÐU WVjj th=g4@t=4@u jVk=4@4@4@/4C@EF4C@jV<=4@ 4@4@E4C@^_ÐU$SWVu95|G@95G@-4C@^_[ÿ0?@߃m MEK ;wEP:@EtYVh(?@ tC߃m KME;w0C@}܃m}0?@rEf8u f␀eEt E^_[Ð-4C@0C@s:=4C@~1Vh(?@ 7(?@+$)4C@=4C@~ ^_[Ð^_[ÐUWVuh:@\ @Ph@h(@, f>fft>f@t7f`t0f t)ft"fPtfE=H @!~5h4@ff%f=@u@@Ph:@\ @Ph@h(@r+ff%f=@~ ~hVnE u h@#}$h@h(@#+=b4@uh@h(@+^_h@h@h(@*=b4@u h@뼐h@ff%f=~h@h(@*=b4@u h@nh@^h4@h:@\ @Ph@h(@W*~u.h @h(@?*=b4@u h,@h:@h<@h(@*hL@ ^_ÐU SWVfu f9wu:! ujhT@jh\@^_[Ðf;@f9;@u T @ff%f=@ud@     h@Ph:@\ @Php@h(@R)*GE+Puh:@\ @Ph@h(@)h@ u f)w ?@^_[ÐUV } ff%f=u=f4@t =b4@tBff%f=@u@@Puh:@\ @Ph@h(@(Wff%f=@~ ~XVvE uh@j}tph@h(@3(=b4@uh@h(@(h@*h@h(@'=b4@u h@Đh@h(@'ff%f=uG~u/h@h(@'=b4@u h@xh"@h$@h(@'ff%f=u1=b4@u(=f4@uh4@h(@P'h@@!} thD@ u V^UVu lG@:@!jVj@Vr ?@^ÐU@SWVuF=(|(Ej F PEP;? }r7h(?@ u 7hl@0?@0C@}~/{.u{t {.u {um͐f;t3^_[ÐE;}~~u:>3u:@:@^Ð>4u:@:@^V:@>:tF>u>tFV:@ ~:@9:@ ~=~&h:@\ @Ph`@ 3:@:@^USWV;@E؁=4@tE54@KLG@ Pj4E uh:@\ @Ph@c u%E t t1C E}t EƀE^_[Ð%^_[Ð3^_[ÐUSWVu@E@+E΁E t=4@5TG@=|4@3 t E}HE Pj<E uh:@\ @Ph@k E%}E % t t#t.}t Eƀ^_[Ð#Eڐ UWV=:@t3;@5:@W;@ PG@Pjx uh:@\ @Ph@ ;@%E t t#t"fEf tƇ^_Ð3f␐USWVu} uWwpG@\G@9~u ^_[ÐugVSjj3* }+Wh@ Wh@F3^_[ÐhFP3) =uɉ~닐VShWFPS tאUVu ~u~Exjjp }*vh@ujh@fƆ^ÐhFPEp =uȋE@Ɔ^ÐhvFPuƆ^ÐUu uh:@\ @Ph@h(@Ch@ uh:@\ @Ph@x ÐUWVuFEEm EEMEE}ۀ=f4@4C@9E}H;@Pff%f=@u8@<@Ph:@\ @PhD@h(@nhh@b4C@9Etef>fftVftO;@Pf@u @@Ph:@\ @Ph@h(@ h@h(@ff%f=@u6F t';@Ph:@\ @Ph@h(@^_ÐUh(?@h\G@vh8C@h\G@dh;@h\G@R5\G@X5`G@J5pG@<5tG@.=t4@t h|:@vÐUWV;@Ph@h(@ h@h(@0PFP* u"0G?:u0Ph@ FPh @h(@ Ph@h(@v vh:@\ @Ph@h(@TF8P,Ph,@j(h.@%h.@h8@h(@ ^_ÐUWVu} EM u^_USWVf=HE@u ^_[ÐHE@0?@3LE@4?@G2|=0?@=0?@~ =0?@2~.h:@\ @PhD@h(@ru4@^_[Ð50?@4?@4?@w>t@6t^_[Ð6u^_[6h(?@ a^_[USWVE~ETG@PjE3NjGGP#E tPZ:@u4@EFN#P8XG@C|E;@9E}AE ;@4h(?@WE=4@O} =4@Z^_[ÐUSWV;@P;@=LE@uPE@E@E3F95;@EEMju!E XG@;@Ő;@ء;@E3F;j4LE@XG@;@4LE@h(?@QEE9=;@~jE0XG@;@EEME Gǹ ut^_[ÐUSWVf=HE@u 0^_[ÐfHE@F@F@F@fF@F@F@=:@t =:@uF@=F@:@=:@; ~ ~~$h:@\ @Ph\@Y fF@fF@hP3;F5ufAfE59|ǡG@HEhh0?@0?@F;Eu+E|G@9E|ݡG@9E}ju uF@=0?@2|30C@E,?@h(?@h\G@hh0?@0?@M 4?@0?@f)}}~3Uf0?@fHE@3ȋ4?@LE@F2|@G@^_[ÐU$SWV u j4F@F@fF@G@+|G@+hG@F@F@F@|G@G@=:@t =:@uF@=F@ :@=:@; ~ ~~$h:@\ @Ph@ fF@fF@G@@E@ G@=L @t L @G@;@+lG@ F@;tf;@f+lG@fF@@G@E|G@EujZEE3F}HjEEP MEEG@9E|ˋEfMf+ G@ PF} EEEƀE;@9E}AE ;@4h(?@EE=|4@:E |4@<^_[ÐU SWV=;@u;@P/;@;@ءG@+|G@;hG@}h@h(@ 3^_[á;@E3F95;@~/  @E@PMEE8uh@3ELE@@E@E;@Euh(?@EE9=;@~$EEME Gǹ uGǹ tEE␐EƀEEMF;}"u=E kh@F2}EE됐^_[ÐUWVujW3 u jW$ XG@hG@^_ÐGG@;u @E@;u3^_ÐUVuFE M u^ÐUWVDG@?t >E9GuDG@=DG@^_ÐUSWVuf>u ^_[Ë4@GC8Cu tF;uf>rf;@f9w ff ;@^_[USWVuf>t ^_[f$?@ff=$?@ރKF;u*ff f+f0KffEff+fufF;rҸ ^_[UVu~.u~.u~uf;@f ^Ð^USWV u3^_[Ðff%fEf=@f ;@f}u=f4@t =b4@t6 t@@Ph:@\ @Ph$@h(@jff%f=@~ VE u;h4@h(@P=b4@uhD@h(@5HhV@r}txhX@h(@=b4@uhd@h(@^_[Ðhn@*hp@h(@=b4@u h|@뼐h@h(@ff%f=uG~u/h@h(@=b4@u h@ph@h@h(@Uff%f=u1=b4@u(=f4@uh@h(@$h@ff%f=u =b4@h@ f;@f$?@f=;@f;@ uf$?@f;@:@LHT @4@F4C@f ;@jVf$?@f;@f ;@f;@f u'h:@\ @Ph@h(@;3f;@f;@ tff%f=@ujjt#f$?@f;@h:@\ @Ph@떐fFtF F ?@F4C@f$?@f;@:@HjV-uh:@\ @Ph@*jj# t[f~uTfF ?@jjj@P t-E2@E\4@9EsEf ;@f9uf :@,IF4C@jVxf;@f;@ t#fF ?@jjj@Pf$?@f;@$?@Ph:@\ @PhL@h(@kPh:@\ @Phh@h(@H^_[ÐUWVu}jE P6譲 }uh@Wu 6ʲ ;u ^_Ðuh@s3^_ÐUWVu}~}3^_ÐjE Pv7 }$uh@+uh@뿐Wu vȲ ;uF^_ÐUja)ÐUSWVu3ۿ tC u^_[ÐUSWVu} 3ۉ]%M E9}|^_[ÐUju腱 jjPB hPa =jj hP" =uohPPk tPhP =u/hPP+ tͯuh@+ÐUSWVu} ]FG8Ft3^_[ËK ^_[ÐU Eh@u華E u;3ËEH@E@t}uh@u\E uːEEyu辮juuP EÐU=S @tD=l4@t;uDu@uu $"E t1EPub tu j5EPuE8txt xh@@!E t0EPu tu jEPuE8txt xh@ t$E8uxu xu jEh@E EPui tu j<}t}t}t܋E8tEPu蹫 tvExtEPEP艫 tFExtEPEPY tEPuOE}jP}u u j]E8t xtxu EPh@TEPu3ÐU=@|5@荩}t juB@ } Ð3Ujj5@ EunEhh@.@5@ E ~3E@.@EEE8 t EM}u}u2}@.@u3Ðju5@p }tEEÐEE+E@Euuu2 tME@EwUVEPkEH@u , t3^hH@EPzE-hV@EPOjkEDPEP E}|hX@EPkEH@@EPjEP襨|@u)}tkEH@j6QZ@^jEP|x |kEHM8<@t(kEH@j|a|kEH4@E|7}tkEH@j^kEH@jEPV h\@kEH@PjEPkEH@P h^@kEH@PاjEPkEH@P[ HE@^ÐUWVEE@/@} }3g@/@^_Ðh`@h@/@VkH@Ph@/@@kHH@t!L@P@P& tEFkH@u}t@^_Ð3kHE9@u @^_ÐFkH@u3^_Ð}hu h@/@P N0@=@/@/uEEA/@E@/@3juV E tF}u$}t*EEj/PE tEkH@uE ^_Ð3FkH@DkHM9@uju VJ ^_ÐUV}|+EERkH@^Ðb@^U}uuj t3ÐUc@ÐUhD=h:t C>u9]t /GC?u>t F^_[Ð3^_[ÐU SWV=T2@uh<%@h0%@<T2@=T2@u ^_[5T2@ ] T2@y5T2@T2@H@ t tCƐ] Nt%C{:t u닐'@t k ǃ0C{:u9u|3^_[ÐU SWVu }EE ~G u 3^_[ÐNoO;|ƋSj wu E t+]])_G ,@+G 3;} Wy}tEE^_[Ð+ ~?W_@yE9Eu_U SWV}] 3CCCCF9u^_[U SWV}] 3CCC2F9u^_[ÐUu PPÐU,SWVE+x%@E؍EP=%@tw) E u#x%@G$j 5%@G(P ^_[áx%@+|%@EwEPW؋EPWEEعQU }EQE@+EE } MEQ;;uEM9H3E9u 9uuE9E} 3E9]| }t }u}tG  tEE؍EPG |%@x%@G$j G 4%@USWVu ~}~-vu);~؋FF;~^_[ÐUWVu} :|v`-mF+F+^_ÐUSWVEQUEE}} EQME<t2@Ex2@Ǚ=|2@Ep2@}|)FGW;E/W)E㐐FGP{EO}|=2@u52@WY=nu L%@3+GH%@;~L%@F2@=2@2@2@h%@h2@t2@^_[ÐU SWVX2@p&@GF uEk@nj&@X2@GFGFGFF]kǤ&@GFGFGF3VdPVdPVdPV~Exd|F2F0E@dPVUX2@^_[ÐUVuƹ uƹd uƹ u n^Ðm^UVuF} |E 0 FE 0F^ÐUVh&@ t>t =l&@u"h2@脒h2@ @l&@3%@%@ >x%@hx%@5%@Vw >@%@ tCx%@-|%@h|%@5%@VC >;t>,u15l&@V^Ðh%@5%@贑|%@^USWVu} 3+'@u+>-t&>+t!>;t>,tC }F>u C|3ۀ>- u>+uFuV tE^_[ÐUWVuu  u%@VWw%@_^VWw%@_^%@G'GPFV>,uGPFV^_UWVu} k 0F'@u^_UWVuE'@tEPViE>:u.EPFVkE<>:uEPFVk}}tE 8^_ÐU VEJ0|994EPuE}|}lE MHE @E x|2E8.u*EPEuE}|} E MHE8/uu EuEE^ÐEPEuE}|}mzE MIaEPEuUE}|}4E kMIH}5u E @l}$}5E @ 3EPEuEMEE ~  E4H%@MyE8.u9EPEuE}|}kE}u E4H%@ E NH^McW_UVEl%@ l&@sF9E9E|^Ð3^ÐWV|$ t$T$L$I|&:tI|:tI|:t I| :u܋^_3^_UVuVQjjF PŒ FFf F tf ^ÐU}u3jEhHuj֌EEE}t7E9Ev )EE'E+EEEEEMuj舌h2@ uuemjVE}| ujG} }}}tEEPEEUjh2@EÐÐÐD$Xpxh Z`P+␋T$D$;j t Zrzj bu@bVt$T$ :t#t:tt:tt :tu3^ËH^ÐUu菋@PE u3ÐuueWV|$L$3ыϋt$+΋|$ ȁ3D$ ^_Ð$Ð5A @t$ t$  Ð;eUSWVuA @ u 3^_[Ð;tsV t^_[ÐUWVu} G8Gu F~=u^_À>u=t3^_ÐV|$3O|$ L$Oϋt$ +D$^ÐUVu'@t &@^ÐUhPu贉 =|hPu薉 =}hPh'@G hPh&@. 3ÐWVt$ |$;t1L$AIt)u*t!ItutItut Itu u3^_W+^_ø7Ðjt$t$9r3ãL@ÐyT$^ÐUu1@u3Uu@u3ÐEÐU=.@ uÐ.@M -@.@3ÐUV5.@Ny^Ð-@Ny^Ð ~h @t @ @lost+found/etc/checklist/dev/recover%c Bad -t option %c %sInvalid cluster size %d %c %c option? %c Incompatible options: -n and -s %c Incompatible options: -n and -q /etc/default/boot/etc/default/bootfsck: could not open default file '%s' FSCKFIX=YESyesYesr%c Can't open checklist file: %s RUNNING fsck1b ./fsck1b%c %sCannot exec /etc/fsck1b %c Can't get memory %c Can't fstat standard input %c %s** Phase 1 - Check Blocks and Sizes %c %sUNKNOWN FILE TYPE I=%u (NOT EMPTY)CLEAR%c %sEMPTY SYMLINK I=%uCLEAR%c %sLINK COUNT TABLE OVERFLOWCONTINUE%c %sPARTIALLY ALLOCATED INODE I=%u (NOT EMPTY)CLEAR%c %s** Phase 1b - Rescan For More DUPS %c %s** Phase 2 - Check Pathnames %c %sROOT INODE UNALLOCATED. TERMINATING. %c %sROOT INODE NOT DIRECTORYFIX%c %sDUPS/BAD IN ROOT INODE CONTINUE%c %s** Phase 3 - Check Connectivity ..%c %s** Phase 4 - Check Reference Counts UNREFUNREFUNREFUNREFBAD/DUP%c %sFREE INODE COUNT WRONG IN SUPERBLK %c %sFIXED FIXBitmap %c %s** Phase 5 - Check Free List %s(Ignored) %c %s%d BAD BLKS IN FREE LIST %c %s%d DUP BLKS IN FREE LIST %c %s%ld BLK(S) MISSING %c %sFREE BLK COUNT WRONG IN SUPERBLK %c %sFIXED FIX%c %sBAD FREE LIST %c %sSALVAGED SALVAGEBitmap%c %s** Phase 6 - Salvage Free List %s SET FILE SYSTEM STATE TO OKAY%c %sFILE SYSTEM STATE NOT SET TO OKAY %c %sFILE SYSTEM STATE SET TO OKAY %c %s%ld files %ld blocks %ld free %c %s*** ROOT FILE SYSTEM WAS MODIFIED *** *** ROOT REMOUNTED *** *** SYSTEM WILL REBOOT AUTOMATICALLY *** %c %s***** BOOT UNIX (NO SYNC!) ***** %c %s*** FILE SYSTEM WAS MODIFIED *** %c %sNO VALID '.' in DIR I = %u %c %sNO VALID '..' in DIR I = %u %c %sMISSING '.' or '..' in DIR I = %u %c %sBLK %ld %c %sDIR=%s %c %sBAD DIR ENTRY I = %u %c %sBLK %ld %c %sDIR=%s BAD%c %sEXCESSIVE BAD BLKS I=%uCONTINUEDUP%c %sEXCESSIVE DUP BLKS I=%uCONTINUE%c %sDUP TABLE OVERFLOW.CONTINUEDUP%c %sDIR pathname too deep %c %sIncrease MAXPATH and recompile. %c %sDIR pathname is <%s> I OUT OF RANGEUNALLOCATEDDUP/BAD%c %sEXCESSIVE BAD BLKS IN FREE LIST.CONTINUE%c %sEXCESSIVE DUP BLKS IN FREE LIST.CONTINUE%c %s%ld %s I=%u %c %s%s DIRFILE %c %s%s=%s (NOT EMPTY) (EMPTY) -- REMOVED (EMPTY) -- REMOVED (EMPTY) -- REMOVED %c %sNAME=%s (EMPTY) -- REMOVED (NOT EMPTY) REMOVEUNREFUNREFDIRFILE%c %sLINK COUNT %s %c %sCOUNT %d SHOULD BE %dADJUSTDIRFILE%c %s%s %s (NOT EMPTY) (EMPTY) -- REMOVED (EMPTY) -- REMOVED (EMPTY) -- REMOVED (NOT EMPTY) -- CLEARED CLEARchkempt: blk %d out of range chkempt: Can't find blk %d /%c %sCan't stat root %c %sCan't stat %s %c %s%s is a mounted file system, ignored %c %s%s is pipedev, ignored %c %s (NO WRITE) %c %sExt. Inode check: isize %d %c %sSize check: fsize %ld isize %d Fast Extended %c %s%s%sFile System: %.6s Volume: %.6s %c %sNEED SCRATCH FILE (%ld BLKS) %c %sENTER FILENAME (not on %s): %c %sCan't create %s %c %sCan't open %s %c %s%s? no yes %c %sAnswer 'y' or 'n' (yes or no) %s %c %sInvalid -s argument, defaults assumed %c %sFatal I/O error %c %sFatal I/O error %c %sFatal I/O error SEEKREADSEEKWRITE %c %sCAN NOT %s: BLK %ldCONTINUE%c %sProgram terminated DIRFILE%c %sPOSSIBLE %s SIZE ERROR I=%u TOO MANY BLOCKS ALLOCATED. DIRFILE%c %sPOSSIBLE %s SIZE ERROR I=%u TOO FEW BLOCKS ALLOCATED. %c %sDIRECTORY MISALIGNED I=%u I=%u OWNER=%s %d MODE=%o %c %sSIZE=%ld %b %d %X %YMTIME=%s %c %sBAD FREEBLK COUNT %c %sDefault free list spacing assumed %c %sDefault gap and cylinder size assumed Not enough free blocks to create bitmap Bad bitmap block allocate Bad bitmap indirect allocate DIRFILE%c %sUNREF %s (NOT EMPTY) MUST reconnect (EMPTY) Cleared (EMPTY) Cleared (EMPTY) Cleared (NOT EMPTY) -- REMOVED RECONNECT%c %sSORRY. NO lost+found DIRECTORY %c %sSORRY. NO lost+found DIRECTORY %c %sSORRY. NO SPACE IN lost+found DIRECTORY %c %sDIR I=%u CONNECTED. %c %sPARENT WAS I=%u SEEKREADSEEKWRITEProblems with raw device %s, please try the cooked device ra/etc/default/langLANG= @english_us.asciitw\@ @english_us.ascii\dd,@4@english_us.ascii8]]<@D@english_us.ascii\\P@X@english_us.ascii|\\d@p@english_us.ascii\]|@english_us.asciiLC_CTYPEctypeLC_NUMERICnumericLC_TIMEtimeLC_COLLATEcollateLC_MESSAGESmessagesLC_MONETARYcurrencylibc: setlocale: : LANG environment variable syntax errorunable to open no line in syntax error in cannot open locale filecorrupt locale fileunknown error CLANG/usr/lib/lang//_./      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~yn-$ +29AKT[dhlptx|%m/%d/%y%H:%M:%SAMPM%a %b %d %X %Z %YSundayMondayTuesdayWednesdayThursdayFridaySaturdaySunMonTueWedThuFriSatJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberJanFebMarAprMayJunJulAugSepOctNovDec%cdeHIjmMSUwWyYaAbBcpxXnthrTD %I:%M:%S AM%I:%M:%S PM%m/%d/%y%H:%M:%STZr/bin/shPATH:/bin:/usr/binsh/etc/passwdrGMT GMT %@%@' ` / w / : /  M w /Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecTZ  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ ((((( H xW@xW@,@W@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_s0.-../fsck2fsstat3mkfs1.-../fsck2fsstat3mkfsL+ p p4@.textppp .data4@4@p4@.bss @ @ .fka000C".fka040@@LB.fka041L@L@.comment" .lib @d@@ @@@ @@$@h@(@( @,@, @@ @@\@4@0@@8@5@ÐET5@RU RPWh4@j'L@ P@jU\WV}th<@h@&jE xjW }WhT@h@ jPVff%f=`tWhl@h@ jPh@|jhV hPV =tWh@h@W j7ff9u<}r^th@h@"jh@h@ jPP uWh@h@ j} ~t&}!~tWh@h@ jEE=8&|tWh,@h@z jZWhH@h@] j=^_ÐÐjt$t$9r3ãL@ÐT$jÐUu1@u3Uu@u3ÐEÐU= @ uÐ @M @ @3ÐUV5 @Ny^Ð @Ny^Ðusage: fsstat special fsstat: cannot open %s fsstat: %s not a block device /fsstat: cannot read %s fsstat: root file system needs checking fsstat: root file system okay fsstat: %s mounted fsstat: %s not a valid file system fsstat: %s needs checking fsstat: %s okay ((((( H @@( @@@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL+ <P*p@.textpp<p .data@@@.bssd(@d(@P*.fka000C".fka040@@LB.fka041L@L@.comment"d8.lib8@$"@@ @@"@4@0@R@8@@@H@@L@ @P@$@(#@(@&@,@&@ÐET@RU RPWh@jL@ PjUTSVEEE Ehd(@6}}>h@h@uh@h@h@uh@j<E @8-uE @xyu EME E @8-uE @xnu EME E @H@EP5H@a }5H@hT@jE @H@j5H@l(@ }5H@hh@j{fEf%f=`u,EPEP, |h|@jA}hhx(@5l(@l =}5H@h@>j3F}x(@8y(@t}Z}t j5H@uh@ h8#@/hhx(@j =x(@yt j~}F Ɔx(@N }h5H@p(@ }5H@h@ij&5H@$h@5H@h(@ 3EEE-5H@h@jkE E0EEЋEH@E t 0|9~Ӄ}:uEEEː}uEEEEE@MHt(@@ jh0@_E }h0@h,@Kjhx0@uF |0@0@E=~h0@hT@ \uhx(@u jj5p(@ hhx(@5p(@f =thh@jtu E @A EEE E}~E@fMff@ǀ ~@ǀ}E @ 0|z9uE @0|h9cE p @E p@ ~=| @=@~ @9@~ @mE }|-E @ 8-u"E @ xEu@ǀ!~ME }E @ 8-E @ xCuvE p >tV7H@E p"H@ME =H@~=H@H@HH@th@jME } @f @f@f @f@@ u @@@@hh@S@ph@>EPh@*@Ph @@Ph(@=H@t5H@hP@@09pw#FP@phd@ jq@fǀ=H@@@ @ + H@@ H@@ȋI+ H@@f@@@ H@@ȋH@ P H@EEƀx(@E}|E!hx(@u+@fE@9EufH@ j@ d(@@Ⱥ8&|+jh5p(@ h5@5p(@ =thx@j=H@tP@EE2E H@ E H@Pu<E EH@9E|š@h@5H@N^[ÐUjjjh@h h`hh@0@P$fjjjjjhjh@0@P$fjjjjjhjh@0@P$f Džk0@E0|7~&h0@uh@ H@EȀfEf-0ff |ufiffH@H@DžƄ|DžDŽL|fDžDžDžDŽ |}uEfDžDžH= =@=`=jh0@E }Th0@h@H@sLPHPPPhPu uE􋅠 EEf@*fLPHPPPh@PLPHPPPh@E@PDž q=0@$u =0@tKLPHPPPh0@H@@PPP럐t$LPHPPPLPHPP ÐUSEEEE  t8]uED[Ðh0@EPh@ H@3[ÐU eEEkE E0EEE0@E t+0|9~h0@h@H@3ÐEÐU!E - } u.h @Cj  t t:tEEEM0@E t t t u֋Eƀ0@ÐUjE P5l(@ hu 5l(@ E=tuh(@jT ÐUjE P5p(@> hu 5p(@ E=tuh<@;j ÐUV=H@@@uhP@j H@ uH@@H@EH@ʰЋȡH@H@ H@E^Ð@@fH@ @D E uhd@Nj @fx5@uF@ @f fHEu@ @L1L0 E}2|ZUV@@fx2|X@ @IEu@ @L1 L0E}2|5@u@f@@fHf@ @UT ^ÐUEEEEEEfMfEEE@E}|EE}}EEMM H uE8@|uuuPÐUEu P%E EE E}|EEMUEE8| hx@WH@EÐU=t(@tt(@t(@áh(@y5h(@Ðh(@H@U\6Dž88Ƅ\8@98|Dž8DžXe8@=@88\u܋X8A8\8@=@8X@9X|fH@LH@PfDžTfDž\fDž^fDžfDžXfDžDž88DŽ88 |=H@Dž8!8H@8@;8}̋8H@ @*8ʈH@@ H@)V5Dž88DŽ88|Džj@ǀ@@HEE=@ E鐐u8@98}~E8+E@M9H~;rQ t|!h@-H@DžMq@)E}~Dž8XPP4ÐÐ#3ÐTÐ;t3ÐL$tÐT$ÐUu1@u3Uu@u3ÐEÐU=@ uÐ@M @@3ÐUV5@Ny^Ð@Ny^ÐUsage: %s special_file %s: cannot determine filesystem type of %s %s: cannot stat filesystem %s %s: didn't exec! errno = %d %s: didn't fork the fsstat process %s: there is no %s of type %s %s: %s is not a mounted filesystem %s: could not read mount table %s: cannot stat %s /etc/fscmd.d%s/%s/%s%s: cannot get dev for %s Cannot lock temp file %s Out of memory /etc/.mnt.lock/etc/mnttab/usr/nserve/.rmnt.lock/usr/nserve/rmnttabwCannot create %s wCannot create %s rCannot open %s rCannot open %s Out of memory Out of memory Cannot read %s nowherenothing%s: %s %d %s Error@@@ @0@H@T@p@@@@@@@@@@(@4@H@X@h@x@@@@@@@@@(@8@D@\@p@@@@@@@ @4 @P @` @ @ @ @ @ @ @ @ @ @4 @D @\ @t @ @ @ @ @ @ @ @ @( @@ @P @` @| @ @ @ @ @ @ @ @ @ @ @@ @X @ @ @ @ @0 @< @X @p @ @ @ @ @@ @8@T@x@@@@@@(@L@p@@@@@@@,@@@P@d@|@@@@@@@@@@@@ @@$@0@<@X@d@t@@@@@@@@@@@@@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in path ((((( H (@(@@(@0@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sroot::0: other::1:root,daemon bin::2:bin,daemon sys::3:bin,sys,adm adm::4:adm,daemon,listen uucp::5:uucp,nuucp mail::7: asg::8:asg network::10:network sysinfo::11:sysinfo,dos daemon::12:daemon terminal::15: cron::16:cron audit::17:audit lp::18:lp backup::19: mem::20: auth::21:auth mmdf::22:mmdf sysadmin::23: nogroup::28:nouser group::50:ingres : # @(#) haltsys.sh 23.1 91/08/29 # # Copyright (C) 1988-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # Begin SCO_BASE # shell script front end to uadmin to stop the system PATH=/bin:/usr/bin:/etc # parse command line : /etc/haltsys(reboot) or haltsys(reboot) arg=$0 cmd=`expr "$arg" : ".*/\(.*\)"` [ $cmd ] || cmd=$arg cd / sync sync umountall 2> /dev/null case $cmd in haltsys*) case $1 in -d) # stay down with no reboot option uadmin 2 3 ;; "") # stay down until a key is stroke uadmin 2 0 ;; *) echo "Usage : /etc/haltsys [-d]\n /etc/reboot" ;; esac ;; reboot*) # shutdown and reboot uadmin 2 2 ;; *) echo "Usage : /etc/haltsys [-d]\n /etc/reboot" ;; esac # End SCO_BASE ȎмPL؀ s Ovi&=4u(s OvG  ع(  u>6t 7@7N ߎǿ1"!"/Sת$ת[VSP tX[^RP+`u$ t uXZhd(40)0123456789ABCDEF boot0: error XX Boot stage : hdboot0 OK ...U,nEr_Dd` ?GnE<><<<<؎мnEnE؎+Ԥ<-<& +f.<ɿ؋<<<&. P<PP8<t Et=닡E%1=t$=zEF=,~F,vpEPvT ;~t.=MEt v,@u==3EE9nEtGVP6nEvhFV=u uF=FV$FVM:EsE EtEEFV t+P6E6Ev? E~|]~ rU PVv  un ^Dt΋=t=uƒ>Juƃ J뱃>nEtpƃ nE+^_]ÐVWwO؎s_^UVWF~vN _^]UVW؎~vF؋N _^]Ë܋W*Ë܋WG[+UF&<Uvvv ]UWV~|'~!v^FPrN uFCnx~}xn~u"tFEvFEtWaEpUr^_]Unx~}xn؁Ô~^uv^+]$!$!USQRV"؃t2ZY[]USQRWVF^t3Ɏ&]&€ _ZY[]USQRWVF^3Ɏ&]&€ _ZY[]USQRX+ұҀuF؁?؀u%PFNV ~~~~ZY[]2UVʀ^^]2þ< uUVWS'[_^]UVWSrÌ[_^]UF=t=ts ]UF] t +udu` ud3Ɋd$ÌÌÌËUVFv2&^]UWVv+DnDlFH+DdTfDpTrDvDxDtV1@u=xFH%FDDEU DT PE PDP0+^_]UWVvv t<u>=t =P +vP=@t>=tḏ=F^?/t=t= t = tG=/uFvvF tnvP@ta^G%=u)SVfF u>=uiv=Py Y~uF1F~ t~ t~^?tV>=u%v=^_]UWVv>= ~>=t =P +#=+PPv^GpWr t݋^xGt^Gvvs@tFxF؀?/u;FF~|F^9W}9Gw^~JFF~}^8tJ^؈N^J/t }FFF4F^OF;|";v^+^~^JF~|ŋ^ƇJvJPF=^_]UWVvDF~}>=t =P+~+|~ s#~^؋GWFVFVRFFFn ^FFV)FVN~~ FPFP/FV9V|9Fs˃~u>=ufvv=PS +^^GWFV u>=u,vv=F~~C^FV9u9tFFVDdTfDpTrF DtDvV-@u^FVF FnFVNG0*^؋WFV tYA^_]U WVvdž~t^?u+DF؋G%=@t>=t=PոRP^ww8. u >=t=F+FF^?u u}F~@|PvvFVVDpTr uRDdTfDpTrDxDtDvV @u.xF~ =u뇉džƇ |郮Dx9v~ ?tdž}?džGȸ݈|Ջ?tPv uU^_]UWVv~8t+F|tG}u^_]UWVvx}x~u[F t=t=tBElUnFVFVElUnRPvvG,EdUfEpUrEvElUnEU^_]UWV~|'~!vv^Nt ^F? uF+nx~}xn~u|tuFEvFEtW EpUrSFElUn;U|;Ev E+ElFv +)PV PvWF ~+F ڋF^_]UWV^wtv~RPwnwl"+^GpWr^t/wrwpS^GpWr u^GdWfGpWr^xGt^Gvv @u ^Gv‹^t`RPwnwlz+F^GlWnȋFڙ+ځË^;G|;Or G+GlFGv^F)Gv^vZFvxwvv` WvV^)vǙ^GlWn^wt^_]UWV~| ~dnx~}xn~u|t|v~RPtntl)DpTrt!RtpVUDpTr tDdTfDpTrDxDtDvV@uDvtKRPtntl0*FLl\n+ځ;\|;Lr D+DlFDvF)Dv|vGF~xLvDlTnGF|tF*^_]U+Pvv]UWV>>t!FxfƇ~F~r>FF~}Dxn؀~uxn~ DDb+DfDdVv u >PFt l\?tv(>PVq@u>=tvZ>P릀=uFDv+DnDlFoVW.F u V;l~t r>POVvu@t+DnDlDvF FF~s^+^_]U WVvFF uzW %u鬘0|9~.u0|9~=bt#~=DtQ=OtL=Su=Ut?=Xt: ^7vF뛋^7P^+P7ܸ ꬘A|Z =dt3=ot=ut)=xus^w73cP^w7O ^F^F umW^WFVW^F& uF6^P&=luJ=ct=du6=ou=sux=uu=xu^_]UV~}-P|FV؃ډFVFRPvv%FV t vvPFRPvvK&؋6>P$^]UVFV&؃6>PFV&؃6>PFV&؃6>PF؃6>Pv^]UWVvޱ >>Pޱ>>Phޱ>>PQރ>>P>^_]UWVvޱ>>Pރ>>P^_]ÐUF=t#= t>= t= t I PQ>;>>t4>v5 P+ P>>u >v]UV>>t+F96>~ v>v>>^]UV>> |~ tu u V^]U>>]øP>P$>P=t >+k>P$ P>PP>P>*P6>>*P>@P6>>P>U>>t>>}'N t>Pi tv6>a+]Ã>>t>>}$ t>P-t6>*Ã>>t>>} t>P%V *<*u U@wu'+؋DZ N6vLJ8vG |@w+G }vu u >Pƅv(vD D ^_]U]UVv ^]UF;FvF]UVvPV lT?^]UVvV lV?^]UVvV lX?^]UWVvFFF(Pv' u.FFF(PP u>P++FFFR?F ^F tvvP uߋ^?uG %Tw-R? DGWDbDhDj~,PW~ u~)PWj t1+DfDd#GWDdTf~)PW= tG~~u >PF^_]UWVvR? =t5V7 u-R? ^_]UVvPV lT?^]øv?P}UV~?PkFR?V?PYF ^7 uP?P>^]UVvDb%PDxPo+^]ø PPmUVv~u?P|vtPtv?PLtNȉN;sDtȠDb%PtttrtpQF t&tttrtpDb%P?P| F*Pz|tȠuPȠPFDtP^]ÐUVFF+^F&^F&F|+^]UWVFF~tm@û&F+G|V+@FV+^F&^F&F|㋇@FF^FV-&&W+㋇@FF^&&WFV _$F w/s-+^F&^F&F|^FV-&&WG|+^_]U WVndwFZwF>~uFFF(FFRPv#F^~&^~E&G^~E&G^~&G^~E&G^~E&G^~E&G ^~E&G>~uvvvvvvv+^_]UV^GbF%F=|N^PwuvB@u @P׋^』PwnDŽXwp vVwP@t+^]UWVvZwF̤PFȤPV tYF؋ȤF%V @F%?E^̤FF*@EEEeȸ؉lw+^_]U^OtNȉN;sGtȠ^GbGvGtGpWr~uP8t%^tȠuwvȠPFGtP+ ]UVv|} Vnt D %VwPuFVDT҉FVFV9V|$9FrFV9Fu9VutD DD6zV^]UVvƠD %t .VwPEFVDDTFVD V@u DV^]UWVPwu \ t u+.VwEF+Pv66FV+Pv66QFP^w VF+P PSF ࣦ+Puvv+Puvv=vPB@P=^1|t6FD^t FF y@P4F&* A? F.* FPvvvƠ t2〧Pw>} vx+FP&D)F+^_]U WV6z uttD *P@Pv6Ơv@PeD %Fn\wFFV^wFFRPFRPvvRP\PFRPFRPvvnRPiPvv@P ^_]+PPPPƠ t +P1ƠUWVvu^Dn@nG|+ǀG|DDD +D$D"PtDRPyD&T(+D,D* uvvV@u|xu&F$<u߱xu|xG~|zu/F$<u"߱@ F=t=u|zG~^xn@t@~uvV@uk+^_]UVvuF%PV@u t +^]UWVvPeW+PV tE W`EFPvV~tWvV uȋ^Ut2] xntv APE W+ DBFFDF^G^+GGDRP+Pt^GW FDŽFFFFn~^GFFPFP^G +FVG FVPFP~^G+FVF Ft*^^G^G^FVGW^FVGW ^F@n\^_]UVFV F^|vPDAP=K^v^vv @uv^ǀ^@ABCDEFGvv +^]UVv^@nF㋀F^@F^㍀ZFDFDF+Pv^GWF-RPFV^G G FV-FV+PvPvFFRPRP-FVRP+Pv^+GWG W^]UWVv^@nF㋀FZP0F؋FG ^GG^vTv{^tG vDF^GF؁?4uZEEEEE+Pv^p(p&FVdRPFVRP@@E E ?EEEEEF4F+v@ȋF+vȉM ^G v+^_]UWVv+^GF9~tGF~vFÉF؀?t@@F ^FF;Fs^8GttztttnGD^GD^GDdD^GD^GD^G D^G D^GD+PtDRPND&T(D^G~^_]UWVvF8u+^xn@u߱@ F=t=ct H~ヸuWF%PV@t@~u vVu@t@~u vV@t@~Fu^X^_]UWVv~FE +EEWTW%^_]U WVv^@nF㋀F|PF؋F%V G ^㋀Z\^GW^vTv#^t^G v`녋^GF؁?4uUB؍^㉀PWvD׃+EU@^H~ F$<t{^G v+^_]U"WVvF^@nF㋀Fر㍀ZFFTFʼnF؋GFދ؋^G~u,^ދF^G^?!CtFPv!+F^F9G~GPW^݉GvF^wvV@tmFPv^㍀F؋? uuDF޸ n؍^^t^G^G vV^G EE+Pvދ^@"P$Fރ-RP ^G E!C+PvFPvV t FPNF^H~FPN^_]UWVv~ljF؋G ^7N }^_]UWVv~^@nF㋀FF%V E ^㋀^`ȋF ڙډM]WTW"t^_]U(WVv^@nF㋀F㋀F؋GFދGF+GFFFF؋FFFFFFFFF 9F}6^܃?t.FN t$~~ًF ũF^FF뿃nFF<n؍^G FF^EFF~|^G FvvVFF^㍀FFF^܋F9u FFNE~~F䙹 uF^FFFF@@;F~^܋F9GuFFF9F~~t^GF;Fv^u FFމG^~UW^^㉀~~^G~~Fؙ uF^FF~t~ ~Ǚ u^GFFFNFFF؃~t(~ ugFFF؋FFF^FG+^_]UWVv^@nF㋀Fn~+$F3+¹3+‹ȋF@F^㍀FF_^u#P^^G^G^G^G^FF~} EFF~}4F9F|^tG ^7^G^G+^_]UWVv^F^@nF㋀F@u^㋀F t^F9r܋^G=vF tNjG F~FEFEFF~}}t ]F9v؋FFFF-FDF+F$FF؋F9uG^G+;^F9v뼋FF9FvFF;FuEF^+F^_]UWVv^@nFF%F^㋸ t=tAQ ^@&P(^_]U WVv^@nFF%FFƉF؋G"W$FV^㋸ t&~t ^AQҋ^G*W,FVFV^_]ÐUVv=@tG~=to~=tw=t'=t=xAP݃YAAAABݸ5BظWBӸBθBɸBĸB뿸(C뺸KC뵸wC밸C뫸C릸C롸D=t=t=t=tVGDP3݃= t=t=t=t= t= t=u}=up= uc=tB=u9=u>=u1=u$=u=ub=uU=k= u$#=u.=u!=u= u@= u=u=u= u=@u^]ÐUSQRVhDFV+ۊgDjDkD:fD |hD kD*fDiD؎^hD.jDiD6kDV r!>hDt#>iDtiD^kDNt+^ZY[]USQRV>fDu1؎^V rNuɈfDɈgD^ZY[]UWVv+~F= t= t=+t!=-uFϋ+ȃ0F*mDuރ~t^_]Ë^_]U`WV~FF+%^FG^FG^FGFF9v^_]UWV~FF+&^FG^FG^FGGF9v^_]ÐUVWN ~4PX%PXߎPX PX~vt tIsF_^]UVWPX%PXߎPX PX~*)ً~v׹Ot tIs_^]UWPX%PXߎPX PX~*ыFuH+_]UVWPX%PXߎPX PX~v+ыtHw_^]UVWPX%PXߎPX PX~*ы~vt tIs_^]UVW+N ~2PX%PXߎPX PX~vً+ًˋtHw_^]U^WN^W]UWVS3F }׋VFVF }׋VF V uNF3؋F<؋NVF u3RPv v(;Vwr;Fv3ҋ t؃[^_]UF^ ؋^u F]ȋFf ȋFы]USW3F }׋VFVF }VF V uNF3F3 uEJ؋NVF u3RPv vQ;Vwr ;Fv+FV +FV u؃_[]22USVF uNF3؋F<ȋ^VF u3RPv v;Vwr;Fv3ҋ^[]USF uNF3F3Fȋ^VF u3RPv va;Vwr ;Fv+FV +FV؃[]2 Boot stage : hdboot1 OK ... /bootCannot open Bad header Bad magic Bad renv Bad extension No ext? Bad text Bad data Stage 1 boot failure: error loading %s null path / not found %s not found %s not found Symlink Loop: bn negative bn ovf %D bn void %D not a directory zero length directory No more file slots Insert media for `%s' and type ENTER when ready: Cannot open device: %s Can't write files ... Sorry 0123456789abcdef>D  getablkNo device passed from boot block! Type '?' for help fdstandalone program load addresshdstandalone program load address? ?,?7/?Boot : Devices are: %s Default device: %s FD: writes not supported FD: unexpected count %d, expecting %d FD error: drive=%d, block=%D, buf addr=%x =MInvalid Fixed Disk Parameter Table Error: request outside range of BIOS (%d cylinders). Attempted write to disk in standalone modeError on Fixed Disk (minor %d), blkno = %D, cmd=%x status=%x Sector = %D, Cylinder/head = %d/%d diskError: Invalid partition sector on hard disk drive %d Error: Too many virtual disks (%d max) on drive %d SENSE_FAIL NO_ERR: status error/error reg=0 WRITE_FAULT: write fault on selected drive NOT_RDY: drive not ready TIME_OUT: attachment failed to respond BAD_SEEK: seek operation failed BAD_CNTLR: controller has failed DATA_CORRECTED: ecc corrected data error BAD_ECC/BAD_CRC: bad ecc/crc on disk read BAD_TRACK: bad track on disk read BAD_SECTOR: bad sector flag detected DMA_BOUNDARY: data extends beyond end of segment BAD_DMA: dma overrun on operation INIT_FAIL: drive parameter activity failed BAD_RESET: reset failed RECORD_NOT_FND: requested sector not found WRITE_PROTECT: write attempted on a write prote cted disk BAD_ADDR_MARK: address mark not found BAD_CMD: bad command passed to disk I/O undefined error (%x) occurred  ((((( H L+ xT'`.p@.textppxTp .data@@'U@.bss-@-@`..fka000C".fka040@@LB.fka041L@L@.comment"}.lib}@$@@@t#@4@0@[@8@@@Q@@U@ @Z@$@L(@(@ ,@,@,@@ ÐET@RU RPWh@jDL@ PRjUdh,@h@/hX@h8@f8@ f8@5,@Pf8@ uh\@#)h@58@5,@58@8@tu u%+}~!h@E pl u 0@EE=0@t=4@t8@E4}u "}u8@ E E8@=8@ u+h@hQ@j uE'<@8@ | 8@8@8@<@jUPE5@h@EPc EPh@5@^E u#j5@h@A" <@ /u jhQ@j jhQ@j -=@@u =<@ t=<@ t=<@ t}t7EjhQ@j 5<@Ph@!@u8@8@<@ =8@t8@8@=<@ uRjhQ@j( j8@9<@t*=<@ t!=<@ t=<@ tE 8@t@@8@=@@t'=@@u <@8@@@=<@ t=<@ t =<@ uI=<@| <@8@8@<@8@8@<@8@jhQ@j4 R<@8@=8@u5@"A8@=8@u RI8@j!8@<@98@tw=8@ t=8@ t =8@ u18@8@<@8@8@<@jhQ@j +<@8@ | 8@8@8@<@E=8@ u :8@8@t @@8@8U Vh@#jj@jjj @thj j h8@(5L@5,@h@ ji jGM|8@tc=8@|Z=8@Qj FP<@8@ | 8@8@8@<@8@8@f ^Ð8@VE@w}t`@E}tEE <@8@ | 8@8@E<@^ÐUV8@9<@8@f ߃8@8@;w荅PEP8@3 =<@ t#f}t5<@ MuLF uFF tN F utN @jFP_ FP N ^F RN I8@8@;0F t8EGF8E;F8E/F8E#jD8@8@8@;v=8@uF $CF8G2*U(SWVu=l@ukEL@EjE܃}}hH @5@*l@ tɃ=l@u u5@hL @ ^_[E}j VE5l@@E} EE:EttVL+E E܃| E 8#uE&uVu  } EfFE E=EE tjWSd j G PC PR Etn5<@ffGE8SufC58@qffG<@f8@fG5<@LPh @G P Wz uGPh @j 5@]E |Rj$Wu }5=L@u,㐐h @h @juW됐SV념u<^_[U SWVu> t> uF󐐐>.t3>/t.>_t)>a|>z~>A|>Z~>0|>9~ @^_[Ð> t> t>t>/uGF> u㻌-@ ;sGC-@r-@^_[ÐUVhL(@h\(@hl(@|jcjYjOh @5$@i u(nh @5$@K u j3V% V jVjh\(@jhl(@h8@hTF PC %8@Q t f8@f8@%8@h8@hTF P h8@h DF P V ^U@EP5$@_@tAEP5@J@t,fE t$fE tfEf9EufEf9EuÐ3ULVEh @5(@  u5(@h @EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPh0 @VHEȃfEf8@fEf8@fEf8@fEf8@E8@EEȋȊL؈8@Eȃ}|E8@E8@E8@=8@t=8@t 8@EV}u^ÐUV5$@ 5$@5 @fh` @5(@jh8@hD@h jh8@hX@T 8@P8@P8@P8@P8@P8@P8@P8@P8@P8@P8@P8@P8@P8@P8@P8@Phd @VHV!+ ^ÐUWVjj jyjjj @thjn h @5$@ u5$@h @g_h8@hTF P @t,%8@ 8@8@h8@hTF Px h8@hDF Pa V h @5(@ u 5L@5(@h @ 8@P8@P8@P8@P8@P8@P8@P8@P8@P8@P8@P8@P8@P8@P8@P8@Ph @V7HV \)j.^_ÐWz@t^_UV=8@jj jjjj @thj Ph\(@R}t;h @h\(@|uuuu uh\(@`h\(@?h8@hTi(@P j-^ÐV@t^ÐGPh\(@}t;h @h\(@uuuu uh\(@h\(@h8@hTi(@P ^ÐUWVSTUVWXYZ[\]^_`abcdefghuEP@tE+@;@|E@^_Ð3^_ÐUVuV#=8@t^=8@t^ÐUu}أ8@ÐUWVu} FO u^_ÐUh}u E @xt h @hl(@jC,EE @60tS1tZ2ta3th4to5tvEuj@h @hl(@8jEʐE뾐E벐E릐E뚐E뎐E낐ji'E8uh0 @hl(@jM+EPhTj fEuMEPhTj EPuT@EP5$@;@hfEf9EZfEf9ELhP @h\(@ uh @h\(@ h @-h @h\(@h\(@jv*hL(@hL(@jEP }nt}y5$@@uh @ j*5$@u@uPL@Euh$ @hl(@O EأL@hB @| 5$@5 @hj)hD @5 @E tuhH @P uE |h @h\(@h\(@E KE ?E 3at-QShl @hl(@fjbtctqsj(ÐUSWVu} ]K u^_[ÐUSWVuF Pr @tCF t @F t @F t @SW^_[ÐW3^_[U4WVuENEYEܨ @h @H uZjjP Èeuj< h @s tEh @[ tEj}Yt }y"E u-jh @uu="@uj' }tEP&E;Eu}t }Yt}yu,EPhTV M0eߍEPhTV ^_UVh @7 t3^Ðjj7Eeuj#h @Z t:h@V th@V  ujjjh% h @  t.h@V th@V u 4@h @ tVJ@h,@ tV)@h<@ tV@hL@i tV@hX@H tV`@j^ÐUjruE u3ÐEE8cu ÐuÐUhh@uEu=v3Ðuhl@h-@Y uh-@ht@h-@<hr@jE uи-@ÐUjuEP4 Eu YEEjh|@ 4jjE@PEfxu @Efxu @Efxu @Efxu @Efxu@Efxu @lEfx u @XEfx@u @DEfxu @/Efxu @Efxu @@PEPEPh@h@58@m$5L@h@Eph @h7@jEphh@hl@58@*5L@Epht@ÐU}t E@} t E @ÐUh"ÐUh?!ÐUjjjfU WVu tQ~ tKf~uD WF PEPD=WVEP D=jEPEP ^_UWVE4fEf@tf}}uoj5 @tLhD@hTV jjVC 8@V!h`jh`jchL(@h\(@hl(@jjjhL(@h@h@ h\(@h@h@ hl(@h@h@ j/h @ u @Gju uh4@Wh<@hP@ u0hh@eE tht@P' u j 5L@Whx@ jj jEPEP+ f@u =L@ uL@8@^_ÐUV@=L@|@9L@} L@4@}tE8tPh@hl(@r 5L@V@u @@Phl(@F^ÐU=d@t5d@}ud@3Ðhh@ud@ u1@UWV=d@u3^_Ðu5d@5d@hh1@ th1@1@ uƆ1@1@$<t!uutWh1@h1@ Wh1@u u1@^_ÐUWVu tt =1@^_Ë=1@E 1@USWVu} F^Sr u^_[ÐUSWVu} ]FFEPB tK ^_[Ð)ÐT$8upT$ Rt$  ÐU(WV=l@}oEPhp@ u"E$ tL@3^_Ðhhhp@ l@ }jhp@pl@ |j$h3@5l@k $t"33@FG$|3@념jj5l@ $3@3@^_ÐUWVuf=3@t7F t8|3~ |)~+"f3@f9Fu 3@^_Ð u3^_Ðf=3@ftft ftfuѠ3@8FuǠ3@8F u3@8F u3@8F 뛐UWVu3@ft-ftfuj G PF P u ^_Ð3 u3^_ÐU,WVE}ԋ =l@}3^_Ðjj5l@ E@tE$<u؍EP u+EP uE Pj5l@jj5l@I j$EP5l@ $t E3@uԹ E3@uj5l@r E^_UWV=l@tjj5l@ 33@FG$|3@^_UWV=l@t5l@l@3@33@FG$|^_ÐUu=~3Ðuhp@ø  3ÐUWVu  u3^_G EG G 3ɉOO ,@at%rtwt*ÐO ~+ug O ^_jju O אUVuVjjF Pr FFf F tf ^ÐUE EE PuhL(@cÐUEEEPu uEÐUVuEEEuuVEEt%3@y VI FFE(jWF PX uEE3@E$@t5E} 3@VEP/Mf]mY 3@VEP 3@VEP- 3@VEPEFFMxlE;sL@"3^_[$@u}$@$@tC$@t7W+؉EE9E|h}}}6EPZ]}t E]}lE@VWu_^3}t}u EmEEE܋ê3@Vj}R-@;u EE tet E/}%EE ê3@yV FF$@g+^-U$@CE@EE}t }t]}lt}huE@fMfE@M 3@VS@u 3@E^_[ÐU SWVu} ] tE@3EEcu u3@Ey u EH@E@t5su E$@u$[u EE8u tEMEK }u3@ 3@& ~! 3@uu@u 3@E9Eu3^_[ t ctE^_[ÐUSWVu} E>^uEFh}PW E]t-u_EM FS}u 3^_[Ð}-u2E]t'F;]}E+@PuP趻 붐EM FFE]u^_[ÐU SWVu3ۉ]]]F>$@uǃ+t -uEFEEF~$@u.uVEE uLF~$@t>+]0} } mE}붐E}  kE ljECM뙐}u|#@^_[ÐEEEteucEE t +t-uEF>$@t3}} kE ǃ0EF>$@uރ}t+]]uSuuu^_[ÐÐjP'ËjP'ËjP'͸ËjP'U}u3jEh3FF^_ø3ÐUWVuE~t~~ FEGFF9F|3FF~u+hv 6( F  uEF3^_Ð~~ ^_øQTÐUVuV(;E tFju 6! F^UjjE0 u3ÐE@MA E@ø7ԫÐ?Ð<ÐUVu }u ^ÐF tF9FwF9Fu߃>uF~u VwNFME^ø@L$tÐX PL$tÐUEEf%Etf=Du]ÐѪT$ÐUu1@u3Uu@u3ÐEÐU=-@ uÐ-@M -@-@3ÐUV5-@Ny^Ð-@Ny^Ð<x ,xx@@@@@ @,@@@P@0 ;,@@@@@ @ @ @ @( @4 @@ @ @  /dev/console/etc/utmp/etc/wtmp/etc/inittab/dev/systty/dev/syscon/etc/ioctl.syscon/bin/sulogin/bin/shSUCannot malloc memory for single_user_command exec -aS%s.lckw+Cannot create %s New run level: %c SINGLE USER MODE execlp of %s failed; errno = %d Internal process table is full. PATH=/bin:/etc:/usr/binCommand is respawning too rapidly. Check for possible errors. id:%4s "%s" exec %sCommand "%s" failed to execute. errno = %d (exec of shell failed) offrespawnondemandoncewaitbootbootwaitpowerfailpowerwaitinitdefaultsysinitrCannot open %s errno: %d exec exec %sCommand "%s" failed to execute. errno = %d (exec of shell failed) r+r+ ENTER RUN LEVEL (0-6,s or S): %cwill change to state %c will change to state %c Usage: 0123456sS %c is not a valid state %c bad character <%3.3o> %cInternal process table is full. run-level %csystem boot%.12sfailed write of utmp entry: "%2.2s" r+r+rwarning: %s does not exist, default settings assumed %x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%xw%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x wUnable to open %s wCan't open %s. errno: %d %x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x:%x INIT: INIT: Usage: init [0123456SsQqabc] Standard input not a tty line This will change the location of the system console to tty %s Are you certain that you want to do this (y/n)? Command aborted due to user response. Answer yes or no (y/n) Can't unlink /dev/sysconCan't link /dev/syscon to %s r+ **** SYSCON CHANGED TO %s **** Usage: init [0123456SsQqabc] Must be super-user r+rw/usr/bin/mapkey/etc/default/bootMAPKEY=SERIAL8=-q/etc/default/bootPANICBOOT=YESyesMULTIUSER=YESyesSLEEPTIME=SPAWN_INTERVAL=SPAWN_LIMIT=INHIBIT=DEFAULT_LEVEL= %s -a %s %s/etc/initscriptoffrespawnondemandoncewaitbootbootwaitpfpwaif initdefaultsysinitUNKNOWN_LEVEL/etc/initscriptINITSH/etc/initscriptCommand "%s" failed to execute with the initscript '%s'. errno = %d -cINITSHCommand "%s" failed to execute. errno = %d (exec of shell failed) /etc/inittab/bin/suloginr+/dev/nullr+/dev/nullr+/dev/null/tcb/lib/initcond/tcb/lib/initcondinit/tcb/lib/initcond/etc/default/securityTCBFILES=OFFexecl of %s failed; errno = %d %s: %s %d %s Error@ @,@H@X@p@|@@@@@@@ @ @,@D@P@\@p@@@@@@@@@@(@8@P@`@l@@@@@@@@ @<@\@x@@@@@@@@@0@H@\@l@@@@@@@@@$@<@P@h@x@@@@@@@@@ @ @,@H@h@@@@@0@X@d@@@@@@@(@H@`@|@@@@@(@8@P@t@@@@@@@<@T@h@x@@@@@@@@@@@@@(@4@@@L@X@d@@@@@@@@@@@@ @,@8@D@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in pathr/etc/utmpGG  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~/dev/ ((((( H @:'i _;?U3R)E?98p)D5} [%/ -I /wb5,6)6d>n G79 85q&5 1Z$.H+jt'!]6$J !5w%^_KLza N } dP@fff&h&QG!+ A j<h"2S58C7{-_k2+/4 U# >D K) m5\W?YU }?^Fz !%ph]( ZJ(9H/9Y!,Z@Z@ ,@Z@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_s# @(#) inittab.sh 25.1 92/10/30 # # Copyright (C) 1988-1992 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # /etc/inittab on 286/386 processors is built by Installable # Drivers (ID) each time the kernel is rebuilt. /etc/inittab is replaced # by /etc/conf/cf.d/init.base appended with the component files in the # /etc/conf/init.d directory by the /etc/conf/bin/idmkinit command. # # To comment out an entry of /etc/inittab, insert a # at start of line. # bchk::sysinit:/etc/bcheckrc /dev/console 2>&1 tcb::sysinit:/etc/smmck /dev/console 2>&1 ck:234:bootwait:/etc/asktimerc /dev/console 2>&1 ack:234:wait:/etc/authckrc /dev/console 2>&1 copy:2:bootwait:/etc/docpyrt >/dev/console 2>&1 brc::bootwait:/etc/brc 1> /dev/console 2>&1 mt:23:bootwait:/etc/brc /dev/console 2>&1 is:S:initdefault: r0:056:wait:/etc/rc0 1> /dev/console 2>&1 /dev/console 2>&1 /dev/console 2>&1 /dev/console 2>&1 /dev/console 2>&1 /dev/console 2>&1 /dev/console 2>&1 Utnм||PSQRWV>t>=usu2:uua}t[}tU}tOu>vu@& &tvtt3Ɏ&E&մ ^_ZY[XQS3ɬɻV^IO ERRBAD TBLNO OSL+  pt@.textppp .datat@t@t@.bss@@ .fka000C".fka040@@LB.fka041L@L@.comment".lib>@@4@0@(@8@u@@ @@("@ @0&@$@@(@@,@@@ @@@ÐETu@RU RPWht@jL@ PjUlXSWVDžEj/E 00@=@E @@5@PzDžPPPu u,h@Ph@5@h@ h@P`"Dž9 -CH9& PPh@ PE( E E}$h@ P@h@P!h@PDž9Kh@ P PJ$h@ PTDž92 PP5@Ph@h@PjPt,uPP 5@5%P5@5@h@h@yj^_[USWVu R@PMu E0.^_[ÐU SWVEEEEE9Emh @EM 4+EE9EEM 4uEEM 4E EPEEM}@^_[ÐUV @=L@| @9L@} L@4( @}tE8tPh @h@" 5L@V @u  @ @Ph@^ÐÐ;MET$*ÐUu1@u3Uu@u3ÐEÐU=@ uÐ@M @@3ÐUV5@Ny^Ð@Ny^ÐAFSAFS%s: default type (%s) used EAFS-E-EAFSEAFS-C-C16/etc/fscmd.d%s/%s/%s%s: there is no %s of type %s -f%s: %s %d %s Error @ @ @ @ @ @ @ @ @0 @@ @T @h @| @ @ @ @ @ @ @ @ @ @$ @8 @L @` @p @ @ @ @ @ @ @ @@$@8@T@p@@@@@@@@8@D@P@\@t@@@@@@@ @@$@8@L@\@t@@@@@@@@$@0@<@P@\@h@|@@@@@@@@@`@@@@@@$@D@d@@@@@@@0@`@x@@@@@@$@0@L@d@@@@@@@@ @,@8@D@P@\@h@t@@@@@@@@@@@ @@,@@@L@X@d@p@@@@@@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in path ((((( H @&@@&@@H&@@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL +  pD@.textppp .dataD@D@D@.bss$@$@ .fka000C".fka040@@LB.fka041L@L@.comment"$.libF@@@$@@, @ @4$@$@@(@@,@@@ @@@4@0@&@8@E@ÐETE@RU RPWhD@jgL@ PPjUSWV}|}~E @xt}ukE @mtEpt4stGWf PE p 3͐P뾾P벃}uE @btcN`J thL@h@ijYE p  } E pE }uSfEff  {3P^_[UVuuu V E@uhh@E^ÐoPyPVJ E^ÐUSWVu3>0u=F^ t=0|7~ ^_[Í0ِ0|9k Ã0F^ u^_[Uhp@h@(jÐU}~ jh@} ~!hh@h@ jUV(@=L@| @9L@} L@40@}tE8tPh@h@ 5L@V(@u @$@Ph@b^Ð3Ð/ÐÐ3ÐÐuT$ZÐUu1@u3Uu@u3ÐEÐU= @ uÐ @M @ @3ÐUV5 @Ny^Ð@Ny^Ðmknod: must be super-user mknodusage: mknod name [ b/c major minor ] [ m/p/s ] mknod: major number must be less than or equal to %d mknod: minor number must be less than or equal to %d %s: %s %d %s Error @ @ @ @ @ @ @ @$ @8 @H @\ @p @ @ @ @ @ @ @ @ @ @ @, @@ @T @h @x @ @ @ @ @ @ @ @ @, @@ @\ @x @ @ @ @ @ @ @$ @@ @L @X @d @| @ @ @ @ @ @ @@ @,@@@T@d@|@@@@@@@@,@8@D@X@d@p@@@@@@@ @H@h@@@@@@,@L@l@@@@@@@8@h@@@@@@@,@8@T@l@@@@@@@@(@4@@@L@X@d@p@|@@@@@@@@@@@@$@4@H@T@`@l@x@@@@@@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in path ((((( H D$@D$@@L$@@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_s: # @(#) mountall.sh 23.2 91/11/07 # # Copyright (C) 1988-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # Mount file systems according to /etc/default/filesys # Begin SCO_BASE if [ "$1" = -a ] then eval /usr/bin/mnt -rc $AUTOFLAG $AUTOBOOT else /usr/bin/mnt -rc fi # End SCO_BASE root:*:0:1:Superuser:/: daemon:*:1:1:System daemons:/etc: bin:*:2:2:Owner of system commands:/bin: sys:*:3:3:Owner of system files:/usr/sys: adm:*:4:4:System accounting:/usr/adm: uucp:*:5:5:UUCP administrator:/usr/lib/uucp: nuucp:*:6:5:Anonymous UUCP site:/usr/spool/uucplogins/nuucp:/usr/lib/uucp/uucico auth:*:7:21:Authentication administrator:/tcb/files/auth: asg:*:8:8:Assignable devices:/usr/tmp: cron:*:9:16:Cron daemon:/usr/spool/cron: sysinfo:*:11:11:System information:/usr/bin: dos:*:16:11:DOS device:/tmp: mmdf:*:17:22:MMDF administrator:/usr/mmdf: network:*:18:10:MICNET administrator:/usr/network: nouser:*:28:28:Network user with no access privileges:/:/bin/false listen:*:37:4:Network daemons:/usr/net/nls: lp:*:71:18:Printer administrator:/usr/spool/lp: audit:*:79:17:Audit administrator:/tcb/files/audit: ingres:*:777:50:Database administrator:/usr/ingres: L+  p @.textppp .data @ @ @.bss@@ .fka000C".fka040@@LB.fka041L@L@.comment".lib@h@@@@#@ @'@$@l@(@,@,@0@@ @@`@4@0@)@8@ @ÐET @RU RPWh @jL@ P$jUh @u uq Edt'lt*st-h( @h@ j#5H@jÐUjjk< }hP @j}U}u0E f@f%f=`uE @ ;@uuh` @3ÐUjj@ } =L@thd @ojjhht @ÐUujk} }0uh| @P PjUV @=L@| @9L@} L@4 @}tE8tPh @h@ 5L@V @u @ @Ph@Z^ÐUPL@EjuẼuEEL@EPuN }=L@ j3fEf%f=@tjuE u=L@ ufjEPuU jEPuU E tEÐuEẼPE uuL@ uuEȀ8tEEȀx/t EEE/EEȉE"EL@Eă8hX@ P h\@Eă P EEEă EEE8tEEME EE9E|݋E}u EuEHPu u E t&uh}u}0uE uu*uuL@EL@u\E uuK=L@PEL@3Ð(.ÐÐ2ÐUVuv Vv6&^U(WVju } 3^_ÐEPWn |2fEf%f=@u$j{ thhF u%fEf%f=@t L@W두>3FF^_ø3ÐÐUWVuE~t~~ FEGFF9F|3FF~u+hv 6( F  uEF3^_Ð~~ ^_øQtÐUVuVt;E tFju 6 F^ø(3ÐW֋|$ 3ыt$ |$ȁD$_ÐUjjE0 u3ÐE@MA E@øÐT$ÐUu1@u3Uu@u3ÐEÐU=@ uÐ@M $@@3ÐUV5@Ny^Ð$@Ny^Ðdls:usage: pipe [ -l | -d | -s pathname ] pipe: setpipe%s pipe: getpipe/devpipe: setpipe: %s%s: %s %d %s Error @ @ @< @L @d @p @ @ @ @ @ @ @@@ @8@D@P@d@t@@@@@@@@@@,@D@T@`@x@@@@@@@@0@P@l@|@@@@@@@@$@<@P@`@x@@@@@@@@@0@D@\@l@|@@@@@@@@@@ @<@\@t@@@@$@L@X@t@@@@@@@<@T@p@@@@@@,@D@h@@@@@@ @0@H@\@l@@@@@@@@@@@@@@(@4@@@L@X@t@@@@@@@@@@@@ @,@8@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in path... ((((( H '@'@,@'@@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sLz+ ;@+ ph @.textpp;p .datah @h @@+h=@.bss8@8@ .fka000C".fka040@@LB.fka041L@L@.comment"h.libh@/@4@0@C@8@i @@9@@=@ @A@$@h3@(@(7@,@,7@@ @@.@ÐETi @RU RPWhh @j 3L@ Pt:jU\WVDž%u uC@uh@hx3@ j :j5@@u"5@h@h3@ j9PhD @t:PhD @tPhD @u"5@h@h3@X jl9EP>  th@h3@&j:9}EP  t=8@t\}tj  t}tj  tu=8@t j8Pf fAH  }h@h3@+j?8=9@#=9@tb59@h8@E u h<@auh`@hx3@ S=8@8@jh8@o u+jh8@D th@hx3@(j<78@98@|h@h3@j78@8@DžPZ tbh@D=8@8@tF th@h3@Xjl6 th@h3@3jG6i th4@h3@j6j6h9@.hp @hx3@}u}th @hx3@hR@hx3@hx@hx3@P!qu j5 DžPhT@P" t<Vh@hx3@} thX@h3@j4 th@h3@j4 j4fjPX ( tht@h3@j(4 %h@fjP ( th@h3@xj3  h@hK Vh@5}u } DžDžh@hx3@hx@hx3@Pqujh9@L+Ph @P tt4h@}uh@hx3@EODž}uh8@Ԑ3 th`@h3@j2jh9@*뛐U SME }E E8-t [ÐEEbtefsʐ9@=8@uME E E8-uEE8nu8@ME }ub{E 0i9`EPh@E 0 u@uh@h3@%ME }u3[Ð9@8@ME }E E8-t}EEEat>dtqt rt'8@ME 릐8@8@8@ME }Na}uh8@h@ h8@h@E 0 ME E}}E 09~ ME }E @8@U V=9@uh @hx3@w3^Ðh$@hx3@_E8@EE?VhT@hx3@2 E}uh^@hx3@EEEE0u9@9Eth`@h3@^Ðh@KUh@@hx3@DžPh@P( t!juuu uPf t{h@hx3@Juuu u0h@hx3@$2}.h@hx3@P qF3Ð@uh@h3@ÐU!EPhH@lP  lt.juuu uEPI  u EȋI9H|1hL@hx3@ uuu uhd@EȋI9H~3Ð}u!hh@hx3@jh9@| E %pE xfpffxf /E Ph!t @uh@h3@`jtE,@u.h@h3@1tO th@뫐|PhDu,S @u2h @h3@t sh8@\t t hd@@f|4t h@+M$Hhu Puuu ulP~P t h@hlP  t h@h@hx3@lPlqujh9@lPh0@lPw lilpu luh4@hx3@oEil tHEil xHEkU}u Ð=9@t}h<@hx3@*hx@hx3@Pqujh9@EPhx@P{ Ett렐8@=9@h@hx3@ tYh@hx3@ t6uuuu u6 h|@8@juuuu u| tlh@N=8@u#uuuu u t?h@!uuuu u, th@h3@j#3U(VE E+E E uh@hx3@|3^ÐE E܋EEE PE tE PE uh@h3@+j?#h@hx3@ 8@E8@E8@E܉EEEEuE@hh@h3@^Ð=8@E8@jE Pu E PuE؀ 8@u Vuu ;}u6E@u h@aEE)EEEE9E+u9u~uuu59@+Eܹd}PVh,@hx3@hx3@jE Pu u VuuB ;}jE Pu u Vuu ;t)}u7E@ h@^E Pu;Et%}TuE@h@"jE Pu= u Vuu ;t5}~EuE@kh@%8@}XEE IE E6uVuKh@U$VE E+E E uh @hx3@3^ÐE EEEE PQE uh @h3@jh@hx3@ 8@EEEEEuE@u{hp@h3@f^Ð=8@u`jE Pu u Vuu ;}uE@u h@댐EE)EEEE9E+u9u~uuu59@+Ed}PVh4@hx3@hx3@jE Pu E PuE܋u Vuu ;}E Pu;Et5}~nE!uE@h@}EE E Euh@UÐU VEEEF}EE@ꐐEE ;E~3Ґu u ^ÐUV3uEEEE 9E}tڋϐ^ÐU E8@8@E=9@1|~h@h3@8@& th@h3@ju th$@h3@~jjh9@E EEE8t}2~롬9@9EthP@h3@(9@EMEE ÐU VEEE EEEH;E|E09u9u}EE^Ð}~"E8th@h3@^3^ÐUVh@hx3@ph@hx3@^h$@hx3@LEt%8@y V FFE(jWF P uEE8@E/@t5E} 8@VEP Mf]mY 8@VEP  8@VEPw - 8@VEP_ EFFMxlE;sL@"3^_[/@u}/@/@tC/@t7W+؉EE9E|h}}}6EPZ]}t E]}lE@VWu_^3}t}u EmEEE܋ê8@V&}R 8@;u EE tet E/}%EE ê8@yV FF/@g+^-U/@CE@EE}t }t]}lt}huE@fMfE@M 8@VS/ @u 8@E^_[ÐU SWVu} ] tE@3EEcu u8@Ey u EH@E@t5su E/@u$[u EE8u tEMEK }u8@ 8@& ~! 8@uuG @u 8@E9Eu3^_[ t ctE^_[ÐUSWVu} E>^uEFh}PW E]t-u_EM FS}u 3^_[Ð}-u2E]t'F;]}E+@PuPr 붐EM FFE]u^_[ÐU SWVu3ۉ]]]F>/@uǃ+t -uEFEEF~/@u.uVEE uLF~/@t>+]0} } mE}붐E}  kE ljECM뙐}u.@^_[ÐEEEteucEE t +t-uEF>/@t3}} kE ǃ0EF>/@uރ}t+]]uSuuuO^_[ÐÐD$Xpxh Z`P+␋T$D$;j t Zrzj bu@bU8SWVu}6~L@"}.@^_[Á}}L@".@^_[Ð t}+Ek 1@E?##@EE@M EEE؋E@؋EEp +ƉE~EE]3m}ueeEu %?ME%?E޸F+EEE?EEE؋??e?e?.E???3EEE*E u$]EEEm␐E} E |E)EMeeEEE؋E?e?e???+E P+Ek 0@E@EE@EEE܋E@E؋E@MMMMMMMMMMMEEEԋE@EЋE@MMM؋EMEE@ E]EEEE?E%?E%?E?#߿?#+E%k 1@E@EԋE@E؋EE܋E@EE@MMMMMMMMMMMEEEE@EE@MMM؋EMEE@ EE?E??EEԁ |ME+EE } EE}IEM E̋K EԉE u5 t1E̋Efs"L@"}.@^_[Ð}u E^_[Ðuuu ^_[ÐU}tE.@uEÍEPu u P@}~B} EE=~TL@"E.@s .@Ð.@Á}| EE=}L@".@uu u ÐUhPu =|hPuf =}hPh/@ hPh.@ 3ÐUVu }u ^ÐF tF9FwF9Fu߃>uF~u VNFME^UEEf%Etf=Du]ÐQT$6ÐUu1@u3Uu@u3ÐEÐU=8@ uÐ8@M $8@8@3ÐUV58@Ny^Ð$8@Ny^Ð 1. Scan entire physical disk 2. Scan a specified range of blocks 3. Scan a specified division 4. Re-allocate bad blocks 5. Modify target parameters 1. Set/Reset AWRE 2. Set/Reset ARRE Select type of scan. 1. Thorough scan (6 Mbytes/min approx) 2. Quick scan (18 Mbytes/min approx) Do you want this to be a destructive scan ? (y/n) The contents of the region you are scanning will be destroyed. Do you wish to continue ? (y/n) Enter list of bad blocks using q to terminate list Enter your choice or q to quit: Scanning in progress, type to quit at any time Usage: scsibadblk - Re-allocate bad disk blocks. Command line options: [-f "devicename"] [-e] [-b [-n] "bad block list"] [-s [-d] [-q] [-r] [-a] ["start block" "end block"]] /dev/rhd00@scsibadblk: cannot open %s for ioctl scsibadblk: can't get disk parameters for %s scsibadblk: not a scsi hard drive scsibadblk: set_bounds failed scsibadblk: check_valid failed scsibadblk: invalid block number %u scsibadblk: scan exceeds device boundary. scsibadblk: invalid scan range scsibadblk: scan failed scsibadblk: scan failed scsibadblk: list_blocks failed scsibadblk: re_alloc failed %d scsibadblk: scan failed scsibadblk: get_range failed scsibadblk: scan failed scsibadblk: get_range failed scsibadblk: scan failed scsibadblk: get_list failed %d AWRE is not a changeable parameter. ARRE is not a changeable parameter. scsibadblk: change parameter failed. Unknown option Unknown option scsibadblk: list_blocks failed %u scsibadblk: failed to record bad block %u%u No bad blocks found. The following blocks have been marked 'bad' %-12u scsibadblk: listing invalid bad blocks Block number or q: %uInvalid block number: scsibadblk: failed to record bad block Are you sure you wish to re-allocate them? (y/n) Attempt data recovery? (y/n) scsibadblk: Failed to malloc in re_alloc Reallocating: %u scsibadblk: lseek failed in re_alloc scsibadblk: re_allocation space full scsibadblk: re_allocation failed scsibadblk: re_allocation space full scsibadblk: re_allocation failed scsibadblk: lseek failed in re_alloc scsibadblk: could not stat device %s scsibadblk: must access physical drive /dev/cbad_block Enter start block number or q to quit: %uInvalid block number: Enter end block number or q to quit: %uInvalid block number: No valid division table scsibadblk: Could not create temporary node scsibadblk: cannot open temporary node scsibadblk: cannot remove temporary node scsibadblk: Could not read in divvy table scsibadblk: cannot remove temporary node scsibadblk: cannot remove temporary node scsibadblk: Invalid division table scsibadblk: fill_divvy failed scsibadblk: print_divvy failed Enter number of division to scan or q to quit: %dInvalid division number scsibadblk: not a recognised option %d scsibadblk: dest_scan failed scsibadblk: rdonly_scan failed scsibadblk: dest_scan failed scsibadblk: rdonly_scan failed scsibadblk: failed to malloc in scan Scanning block %u, %u %% complete, bad block count = %u scsibadblk: record_bad failed scsibadblk: record_bad failed scsibadblk: record_bad failed scsibadblk: record_bad failed scsibadblk: record_bad failed scsibadblk: failed to malloc in scan Scanning block %u, %u %% complete, bad block count = %u scsibadblk: record_bad failed scsibadblk: record_bad failed scsibadblk: record_bad failed scsibadblk: exceeded bad list capacity. scsibadblk: list_blocks failed scsibadblk: re_alloc failed in record_bad scsibadblk: couldn't locate end of bad_list. scsibadblk: check_valid found invalid block list +----+------------------+-------------+-------------+ | # | Filesystem | First Block | Last Block | +----+------------------+-------------+-------------+ | %-2d | %-17s| %-12u| %-12u| +----+------------------+-------------+-------------+ Block numbers are %d byte offsets from start of physical disk. scsibadblk: getdevname failed /devgetdevname: open failed scsibadblk: illegal parameter in change_mode. AWREARRE %s is not enabled. Enable %s ? (y/n) %s is enabled. Disable %s ? (y/n) Scan interrupted .. scsibadblk: lseek failed in sigcatcher scsibadblk: write failed in sigcatcher scsibadblk: list_blocks failed scsibadblk: re_alloc failed in sigcatcher This device spans blocks %u to %uPlease answer yes or no: %s: %s %d %s ErrorL"@T"@`"@|"@"@"@"@"@"@"@#@#@,#@@#@T#@`#@x#@#@#@#@#@#@#@#@#@$@$$@4$@D$@\$@l$@$@$@$@$@$@$@$@%@4%@D%@T%@p%@%@%@%@%@%@&@&@ &@8&@P&@d&@|&@&@&@&@&@&@&@&@'@ '@8'@X'@p'@'@'@'@'@'@'@'@(@(@ (@,(@@(@T(@`(@|(@(@(@(@)@$)@d)@)@)@)@)@)@*@(*@H*@\*@|*@*@*@*@*@$+@<+@\+@l+@+@+@+@+@+@,@(,@L,@p,@,@,@,@,@,@,@,@,@-@-@ -@,-@8-@D-@P-@\-@h-@t-@-@-@-@-@-@-@-@-@.@.@.@(.@4.@H.@T.@`.@l.@x.@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in pathGG  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ ((((( H @:'i _;?U3R)E?98p)D5} [%/ -I /wb5,6)6d>n G79 85q&5 1Z$.H+jt'!]6$J !5w%^_KLza N } dP@fff&h&QG!+ A j<h"2S58C7{-_k2+/4 U# >D K) m5\W?YU }?^Fz !%ph]( ZJ(9H/9Y!,A@A@(7@A@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sLk+  p$ @.textpp p .data$ @$ @$ @.bss@@.fka000C".fka040@@LB.fka041L@L@.comment".lib2@@4@0@#@8@% @@@@ @ @(!@$@@(@@,@@@ @@@ÐET% @RU RPWh$ @jG L@ P0 jU SE @jL@ u"5@h, @h@ j EPh@E@ uƀ@E@EE t @tE@u#EEE@uE8u h@>ujuh@5@< u"5@hL @h@: j h@hh@ 5@ u"5@hh @h@ j[ÐUu5@h @h@ÐU}u3Ðhu lMA |jjEpO }$Ef@tu h @h@Y 말ÐUWVjE u#fEth @h@3^_ÐEȋЋ3~ zy8ExEMHE^_Uh @h @uÐUh @h@uÐUtuZE u3Et"uu uuאEtVh@u VE ufEtu h@h@7 uhu EEEPu  }/h*@u E uHfETu h,@뇐h>@u E ufE%u h@@UjLE u_uZufEhd@hP@u DE ufEu hT@ujjHu&tUuE@ umufE;u h@h@ !E@HE8uȋUQE@MHHEMHjLE Juu:fEht@h@?u Eȋ HU V}u3^Ðu EuEE;EEE } E1E EE EE;EEEjL E {ju P E@ujE EEE} |mE juE PE E@?E P EEE@ E} |mEEfMfH@EMHDE@HE8t+@MHHEMHExyMHnEȋЋurq0VjLE ph@Plh@E PX}~Oju EPR E@EP-E EEE} |mE EEEE} |}~TjuE(P E@?E(PEEE@ E} |mE"EEE@ E} |Ef@@E@DE@HE@MHHEMHM^ÐUh@uÐUh@uÐU }th@u E u3ÐEEE@ EjjP ujjHuE@HE}uujÐUV}tCFHEE0vEME0 u܃x~ puI^ÐUfE}} EE EEEE t tSt^taL@fEEPju E}}zL@tfta.t\dfEEPjƐfEfEEPju< Etf}u3ÐL@ ÐL@-EÐ>ÐÐT$zÐUu1@u3Uu@u3ÐEÐU= @ uÐ @M @ @3ÐUV5 @Ny^Ð@Ny^Ð%s: cannot create mount table %s: cannot set mount table %s: cannot write mount table %s: illegal line <%s> Cannot lock temp file %s Out of memory /etc/.mnt.lock/etc/mnttab/usr/nserve/.rmnt.lock/usr/nserve/rmnttabwCannot create %s wCannot create %s rCannot open %s rCannot open %s Out of memory Out of memory Cannot read %s nowherenothing/etc/mnttab/usr/nserve/rmnttabw ((((( H 8!@8!@@@!@@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL+  p$ @.textppp .data$ @$ @$ @.bss!@!@ .fka000C".fka040@@LB.fka041L@L@.comment"!.lib*!@@@%@@)@ @-@$@@(@@,@@@ @@@4@0@/@8@% @ÐET% @RU RPWh$ @j_L@ P0jU}| E @8-tjE @@at:dt luYR}}QjE p p)}})jE pp p jÐUhP @4h` @'h @ÐU,SWVwWjF }h @jh @3؉E }Eh @uh @|FPFPv PPh( @SFt h@ @hH @7C }:~tPW Vh @h @{^_[ÐUWVu }EGwWj }hL @j^_ÐUSWVu u]ECs{ Sj }hT @j^_[UWV3_, @0 @0 @u7, @h\ @h@V hx @h@Dh @F|^_USWVu3)j40 @fV, @Py ujG}b<0 @t4, @ }4, @h @h@ h @h@h @0 @3^_[ÐU$SWVu} v9 f;tC Ph @h!@& EPh!@ }'h!@h @h@ h @z딐E;ufEf%f=`y6h!@h @h!@C Ph @h!@!@P !@^_[Ð3^_[ÐUV @=L@|p@9L@} L@4 @}tE8tPh @h@F 5L@V @u @ @Ph@^ÐÐ2pÐU(WVju } 3^_ÐEPWn |2fEf%f=@u$j# thF u%fEf%f=@t L@WC두>3FF^_ø3ÐÐUWVuE~t~~ FEGFF9F|3FF~u+hv 6( F  uEF3^_Ð~~ ^_øQÐUVuV(;E tFju 6A F^UjjE0 u3ÐE@MA E@øÐT$zÐUu1@u3Uu@u3ÐEÐU=!@ uÐ!@M @!@3ÐUV5!@Ny^Ð @Ny^Ð< @H @/dev/dsk/devusage: swap -l swap -d swap -a swappath dev swaplo blocks free ?????? %.18s %s%.*s%2d,%-2d %6d %6d %6d INDEL swapswapCouldn't open directory %s - not being searched. swapCouldn't chdir to %s - directory not searched. swap%sCould not stat %s.nswap/%s%s: %s %d %s Errort@|@@@@@@@@@,@@@T@h@|@@@@@@@@@@$@8@L@\@l@@@@@@@@@$@@@\@l@|@@@@@@$@0@<@H@`@x@@@@@@@@@$@8@H@`@@@@@@@@@@(@<@H@T@h@|@@@@@@,@L@@@@@@@0@P@p@@@@@@@L@d@@@@@@@@8@P@t@@@@@@@ @@$@0@<@H@T@`@l@x@@@@@@@@@@@@,@8@D@P@\@p@|@@@@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in path ((((( H (-@(-@@0-@@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sansi console ansi syscon ansi systty ansi tty01 ansi tty02 ansi tty03 ansi tty04 ansi tty05 ansi tty06 ansi tty07 ansi tty08 ansi tty09 ansi tty10 ansi tty11 ansi tty12 unknown tty1a unknown tty2a dialup ttyp0 dialup ttyp1 dialup ttyp2 dialup ttyp3 dialup ttyp4 dialup ttyp5 dialup ttyp6 dialup ttyp7 L+ P p@.textppPp .data@@@.bss@@ .fka000C".fka040@@LB.fka041L@L@.comment".lib@D@@"@@&@ @*@$@H@(@@,@ @@ @@4@4@0@|,@8@@ÐET@RU RPWh@j3L@ PjUWVEjE}t"}th@hh@j{E ptE pf}th@hh@j-E @8bu33E @8cu h @hh@jL@jEu%=L@th0 @hh@>ju7E p WV~ E=L@thX @%uh` @^_jWVK hd @ ^_ÐUV @=L@| @9L@} L@4 @}tE8tPhl @hh@ 5L@V @u t @| @Phh@Z^Ð"ÐÐULVu u3^ÐEPu |fEf%f= uh<@E tžuE u$ju.N uu덐Eԃ8t tM9uh<@h@qEԃ Ph@-EPh@ wfEf9EifEf%f= W tfEf9EEu @^UVuv V6^U(WVju } 3^_ÐEPWn |2fEf%f=@u$j thF u%fEf%f=@t L@W7두>3FF^_ø3ÐÐUWVuE~t~~ FEGFF9F|3FF~u+hv 6( F  uEF3^_Ð~~ ^_øQÐUVuV;E tFju 6 F^ø3ÐV|$3O|$ ыt$ D$^W֋|$ 3ыt$ |$ȁD$_ÐUjjE0 u3ÐE@MA E@øÐ7ÐT$ÐUu1@u3Uu@u3ÐEÐU=@ uÐ@M @@3ÐUV5@Ny^Ð@Ny^ÐUsage: uadmin cmd fcn [mdep] uadmin: A_GETDEV requires the mdep argument. uadmin: invalid option uadmin: Can only be executed by root. uadmin%d uadmin%s: %s %d %s Error @ @ @ @( @@ @L @h @| @ @ @ @ @ @ @ @ @ @, @@ @P @` @p @ @ @ @ @ @ @ @@ @0@<@T@h@@@@@@@ @,@H@X@|@@@@@@@@@,@<@T@l@x@@@@@@@ @ @8@H@X@t@@@@@@@@@@@8@P@x@@@@(@4@P@h@@@@@@@0@L@p@@@@@@ @D@h@@@@@@ @$@8@H@\@t@@@@@@@@@@@@@@@(@4@P@\@l@|@@@@@@@@@@@@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in path/dev/ ((((( H *@*@@*@@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_s: # @(#) umountall.sh 23.1 91/08/29 # # Copyright (C) 1988-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # Copyright (c) 1984, 1986, 1987, 1988 AT&T # All Rights Reserved # THIS IS UNPUBLISHED PROPRIETARY SOURCE CODE OF AT&T # The copyright notice above does not evidence any # actual or intended publication of such source code. # Unmounts all but the root, "/", file system. # Note: written to depend on as few commands as possible. #! chmod +x ${file} kill= if [ $# -ge 1 ] then case "$1" in -k ) if [ ! -x /etc/fuser ] then echo >&2 "$0: -k option not available. No /etc/fuser found." exit 1 fi kill=yes ;; * ) echo >&2 "Usage: $0 [ -k ] -k kill processes with files open in each file system before unmounting." exit 1 esac fi /etc/mount | sort -r | while read fs dummy1 dev mode mode2 dummy2 do case "${mode}" in 'read/write/remote') mode=-d # remote resource ;; 'read') case "${mode2}" in 'only/remote') mode=-d ;; esac ;; esac case "${fs}" in / | '' ) continue ;; * ) if [ "${mode}" = "-d" ] then /etc/umount -d ${dev} else if [ ${kill} ] then /etc/fuser -k ${dev} sleep 10 fi /etc/umount ${dev} fi esac done H...Ilibc_sJlibnsl_sLI'd#CL@.textCd .data@@L`@.bssL@L@.comment"Ld.libnd5[upz5/73i36{u55?55/L50d q ?i5` 1 +,c5 d5i57w52i3*c5"  ^5ah5-......45vy33'3e5DO Vi5|55n4i4d4_4Z4U4P4K4F4A4<47424-4(4#44444 4443333333333333333333333333~3y3t3o3j3e3`3[3V3D$yÐUVuA|Z^ÐUVu }u ^ÐF tF9FwF9Fu߃>uF~u V^NFME^WVt$ |$;t@uAt8u9t0u1t(u)t u!tututu u3^_W+^_ÐUV}t} u-Eu@ t,ujV ^ÐEm E+u;E t3^Ë^ÐUu@ÐUSWVE}v3^_[á@8u8ȃ@ȀH@d@@`@d@l@E؋5`@Eu65`@9=l@u5l@>tE;w;O$;w9=d@L95@@E}v5l@j1d@;t<Ee ǹU t:+‰ENjEE'd@+l@+؉EEe E;EE=vh0@mu0@u+EP0c=l@d@8E+EDd@;td@ȋ d@ @o`@;sh@`@`@ 95l@u `@l@F^_[ÐUVu5`@$d@9u5l@^ÐUSWV}Gt WG+Eu b t9uu^_[ÐE EE9EsEEEPuV ;sŋEE;r+ h@ USWVu} ]CuF~uNGF tKuNE^_[ÐUSWVu} ]GF;u^_[My3^_[WV|$ t$L$Njʁ^_USWVu] }uF^OyE^_[ÐUSWVu} F~uNGF u^_[ÐW֋|$ 3ыt$ |$ȁD$_ÐW|$3A_ÐUWVu~u V- F uF N F Dt(=$@(@98vG @tW|㐐FFF tF ,@+FPvF P- x FF^_Ã>tN N F tf ^_ÐUSWVuEm 9}w9} v 3^_[Ð>(V@uE H+u ȋE+^_[N;rNjSvu ÉE)^F ,@+F 3;} V +uE^_[ÐUVuy Vs^ÐFF^U SWVu }EE ~G u 3^_[ÐNwO;|ƋSj wuE t+]])_G ,@+G 3;} W}tEE^_[Ð+ ~?W@uE9EuWU VEE$@8,P{@uE9E3^á$@H$@$@0Vj puHE t+uu$@)0$@p$@@ ,@ $@+A 3;}5$@}UMEE^ÐU$@y5$@á$@H@U SWVu}(F u#F uy Vv FFKyF uF t ^_[ÐE^_[USWVu 3F $<u~tF9Fu>uF Du V3 t ^_[F ,@EF  V@t΋ENM+ ~SjuQE t+]K)^F ,@+F 3;} V}tF @tV@Y^_[]|u,EPuF P* E^_[ÐUSWVu }%yVGGP GNFKyF % ^_[UVu yVEP^ËFFM^ÐUS]$@Hy$@PP[Ð$@H@[ÐUVua|z^ÐUSWVu} t<}t6F $<u~tF9Fu>uF DuV3 t 3^_[ÐF ,@EEm 9}w9} wԋF9FreF urWWuF P( ;t N 3؋+u ^_[ÐV@uE H+u ȋE+^_[Ð]ENM+ ~ȋ;rËSuuz )^F ,@+F 3;} V,+uF Dt'F uF+FPj vP% t VE^_[UV5$@ V(@90w^UWVu tdF t5F t3 VVF P% }L@F tv@FF FF^_ÐUVuF u(7F t~tF9FvV6F tF t ^Ð3^ÐUVu F $RuF DuV3 u;F D:V>yVEPENFF t ^ÐE^ÐUSWVu^~+؉~F Dt3F ,@+FF ,@+F 3;} V ~!SWF PE% ;tN ^_[3^_[ÐUVuF $<tF u ^ÐF $ F ~u VNF9Fu=F Du7F ,@+FF ,@+F 3;} V3^ÐUSWVu^ F t ,@ @N }' u@@FN ,@Nh@F tN F ,@VF ,@ @VFFW t F uN @^_[USWVuF ,@+F }^^_[9>~>^_[ÐUWVuf F }}i~tcF u]>E E}ujjF Pu" +E)} F u+ ~'9}"F+F;EEFE)F t FFf uu F P" E=F t5VF t f FFuu F P! E}u ^_Ð3^_ÐUSWVu} ]uCt GF u t FuE^_[ÐUL@EEPhTu%! }EL@3ÐÐUDPu u(ÐUVuVSVu u ^ÐU SWVu t}tE8u 3^_[ÐE x+E at:rtQwu t؀hSu E }2 tf̐ t3븐EF tE 8ruF E 8au ujju *F ,@3҉VV^_[UV5$@(@90v F u^Ð3^ÐUSWV3$@@$<u!$@xtȋI9Hu"xu@Du$@P$3 t ^_[á$@@ ,@E$@P^@tʋE $@Y+Ë ~WjuSE t+$@)x$@x$@@ ,@ $@+AI 3;}$@P}t1$@@@ $@@DtP@!^_[}HUVEEE@ u @ t H uuu v E@ t^Ë^ÐUVE E$@@u @t(H$@Puu" $@@ t ^Ð^ÐUVEEEEEEXtF>t ajuw  u#>z~juZ  uEE^_[ÐUSWVu8@ u 3^_[Ð;tsV t^_[ÐUWVu} G8Gu F~=u^_À>u=t3^_ÐU SWV=t@uV@@9E~E @@;-u{u ^_[Ðhx@E @@4* u @@ΐE @@t@05D@:tVu =<@tSƈEE E 0PE 0j h\@Ph\@j jEPju E @@t@t@8u@@t@?^_[ÐG?:E @@t@xtE @@t@@@@@@9Ed=<@tƈEE E 0PE 0j h8@Ph8@j jEPj 9k FN+0>0}}t ^_[Ð^_[ÐU SWVu3}@@uNF@DuÃ+t-uEF@Du3^_[Ð>9k FN+0>0}}t ^_[Ð^_[ÐUSWVu] }F8^u N^_[ÐOy3^_[ÐUSVu] 8u ^[ÐF~u3^[ÐUSWVu} ]C;t u u3^_[G8GuF~u萐O+^_[ÐUSWVu] 38uF~u^_[ÐL@Ð3Ð!Ð 3Ð3ÐÐ>rÐ^3ÐÐ66Ð%"3Ð ÐÐÐT$t0@Ru 0@+D$øT$0@3ø3Ð T$tÐ Z3ÐBÐ.ÐU SWVu3ۉ]]]F>@@uǃ+t -uEFEEF~@@u".uXEE uNF~@@t;+]0} } mE}E}  kE ljECM뒐}u|@^_[ÐEEEteukEE t +t-uEF>@@t6}} kE ǃ0EF>@@uك}t+]]uSuuu^_[ÐUVu tE@uE^ÐEPu u P@ ~lE=~3L@"E@s @^Ð@^Ð~@M]鐸EEM^ÐE=}L@"@^Ð}@M]EEu^ÐU8SWVEEEMq%-E=uEPEp0 E?E0#ljE #E@# +E  P+E k @E@E܋E@E؋E@EԋE@MMMMM MMMMEEEЋE@E̋E@MMM؋EMEE@ E]EE E?E%?E%?E?#߿?#+E %k @E@EЋE@EԋEE؋E@E܋E@MMMMMMMMMMMEEEE@EȋE@MMM؋EMEE@ EE???e?EE ؈E̋ƊMEH#E!NJM‰E?#]} E^_[ÐMeEE????+Ek @EE̋E@EMMMEE@ EE E֋ME%?M‹M$U8SWVu}6~L@"}<@^_[Á}}L@"D@^_[Ð t}+Ek @E?##@EE@M EEE؋E@؋EEp +ƉE~EE]3m}ueeEu %?ME%?E޸F+EEE?EEE؋??e?e?.E???3EEE*E u$]EEEm␐E} E |E)EMeeEEE؋E?e?e???+E P+Ek @E@EE@EEE܋E@E؋E@MMMMMMMMMMMEEEԋE@EЋE@MMM؋EMEE@ E]EEEE?E%?E%?E?#߿?#+E%k @E@EԋE@E؋EE܋E@EE@MMMMMMMMMMMEEEE@EE@MMM؋EMEE@ EE?E??EEԁ |ME+EE } EE}IEM E̋K EԉE u5 t1E̋Efs"L@"}4@^_[Ð}u E^_[Ðuuu ^_[ÐUSWVu} ƹ ر *0O uߋ^_[Ðr.,?? 000000000000000000000123456789ABCDEF0123456789abcdefnan0xNAN0XinfINF-+ 0x0X--+ --+ -(null)-+ : option requires an argument -- : illegal option -- --GA>@:'i _;?U3R)E?98p)D5} [%/ -I /wb5,6)6d>n G79 85q&5 1Z$.H+jt'!]6$J !5w%^_KLza N } dP@fff&h&QG!+ A j<h"2S58C7{-_k2+/4 U# >D K) m5\W?YU }?^Fz !%ph]( ZJ(9H/9Y!,G@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_s.file gbranchtab.text.data@.bssL@.comment.lib.filegctype_def.c.text.data@.data@.bssL@DGROUP@.file"gmall_def.c.text.data@.data @.bssL@DGROUP@.file-greall_def.c.text.data @.data@.bssL@DGROUP @.file8gfree_def.c.text.data@.data@.bssL@DGROUP@.fileCgstdio_def.c.text.data@.data0@.bssL@DGROUP@.fileNggen_def.c.text.data0@ .data<@.bssL@DGROUP0@.fileYgopt_data.c.text.data<@.dataL@.bssL@DGROUP<@.filecgi386_data.s.text.dataL@.bssL@.comment .fileng_fac.c.text.dataP@.dataX@.bssL@DGROUPP@.filexgfpreal.s.text.dataX@.bssL@.commentP .fileglct_num.c.text.data\@.data`@.bssL@DGROUP\@.filegabs.s.text .data`@.bssL@.commentp8.filegold_tlwr.c.text.data`@.data`@.bssL@DGROUP`@.filegungetc.c.textX.data`@.data`@.bssL@DGROUP`@.filegstrcmp.s.textp`.data`@.bssL@.comment.filegcalloc.c.textp.data`@.data`@.bssL@DGROUP`@.filegmalloc.c.text@*.data`@.datap@.bssL@DGROUP`@.filegstrncat.c.textD8.datap@.datap@.bssL@DGROUPp@.filegmemccpy.c.text|4.datap@.datap@.bssL@DGROUPp@.filegmemcpy.s.text$.datap@.bssL@.comment.filegmemset.c.text(.datap@.datap@.bssL@DGROUPp@.filegstrcat.c.text,.datap@.datap@.bssL@DGROUPp@.filegstrcpy.s.text(4.datap@.bssL@.comment.file gstrlen.s.text\.datap@.bssL@.comment.filegfilbuf.c.textt.datap@.datap@.bssL@DGROUPp@.file#gfread.c.textD .datap@.datap@.bssL@DGROUPp@.file.gfgetc.c.text $.datap@.datap@.bssL@DGROUPp@.file9gfgets.c.text .datap@.datap@.bssL@DGROUPp@.fileDggets.c.text  .datap@.datap@.bssL@DGROUPp@.fileOggetchar.c.text ,.datap@.datap@.bssL@DGROUPp@.fileZggetw.c.text `.datap@.datap@.bssL@DGROUPp@.fileegfputs.c.text0   .datap@.datap@.bssL@DGROUPp@.filepgputw.c.textP L.datap@.datap@.bssL@DGROUPp@.file{gfputc.c.text 0.datap@.datap@.bssL@DGROUPp@.filegputchar.c.text @.datap@.datap@.bssL@DGROUPp@.filegold_tppr.c.text .datap@.datap@.bssL@DGROUPp@.filegfwrite.c.text(t .datap@.datap@.bssL@DGROUPp@.filegflsbuf.c.text(!.datap@.datap@.bssL@DGROUPp@.filegfseek.c.text .datap@.datap@.bssL@DGROUPp@.filegstrncpy.c.text@.datap@.datap@.bssL@DGROUPp@.filegisatty.c.text<.datap@.datap@.bssL@DGROUPp@.filegfopen.c.textLL.datap@.datap@.bssL@DGROUPp@_endopen.filegfindiop.c.text0.datap@.datap@.bssL@DGROUPp@.filegputs.c.textD.datap@.datap@.bssL@DGROUPp@.filegfprintf.c.text L.datap@.datap@.bssL@DGROUPp@.filegprintf.c.textXX.datap@.datap@.bssL@DGROUPp@.file gsprintf.c.textH.datap@.datap@.bssL@DGROUPp@.filegfrexp.c.text.datap@.datap@.bssL@DGROUPp@.file"gisnand.s.bt50'+d.text,.data@.bssL@.comment .file,gfpreal.s.text.data@.bssL@.comment.file7gmemcmp.c.text8.data@.data@.bssL@DGROUP@.fileDgdoprnt.c.text.data@p.data@<.bssL@DGROUP@_dowriteH.fileOgmktemp.c.text+.data8@.data8@.bssL@DGROUP8@.file[ggetenv.c.text|,t.data8@.data8@.bssL@DGROUP8@nvmatch,.filefggetopt.c.text,H0.data8@@.datax@.bssL@DGROUP8@.fileqgsetbuf.c.text8/.data|@.data|@.bssL@DGROUP|@.file|gsignal.s.text/t.data|@.bssL@.comment8`0.filegecvt.c.textl0 .data|@.data|@.bssL@DGROUP|@cvt0.fileggcvt.c.text24.data|@.data|@.bssd@DGROUP|@.filegatol.c.text3.data|@.data|@.bssd@DGROUP|@.filegatoi.c.textD4.data|@.data|@.bssd@DGROUP|@.filegmemchr.c.text40.data|@.data|@.bssd@DGROUP|@.filegstrchr.c.text5(.data|@.data|@.bssd@DGROUP|@.filegstrncmp.c.text,5H.data|@.data|@.bssd@DGROUP|@.filegstrrchr.c.textt5(.data|@.data|@.bssd@DGROUP|@.filegcerror.s.text5 .data|@.bssd@.comment,.filegclose.s.text5.data|@.bssd@.commentH8.filegaccess.s.text5.data|@.bssd@.comment8.filegchdir.s.text5.data|@.bssd@.comment8.filegchmod.s.text5.data|@.bssd@.comment8.filegcreat.s.text6.data|@.bssd@.comment(8.filegfcntl.s.text6.data|@.bssd@.comment`8.file%gfstat.s.text,6.data|@.bssd@.comment8.file/ggetpid.s.textD6.data|@.bssd@.comment8.file9gioctl.s.textT6.data|@.bssd@.comment8.fileCgkill.s.texth6.data|@.bssd@.comment@8.fileMglseek.s.text6.data|@.bssd@.commentx8.fileWgopen.s.text6.data|@.bssd@.comment8.fileagread.s.text6.data|@.bssd@.comment8.filekgsbrk.s.text6D.data|@.bssd@.comment 8.fileugstat.s.text7.data|@.bssd@.commentX8.filegtime.s.text7.data|@.bssd@.comment8.filegunlink.s.text07.data|@.bssd@.comment8.filegutime.s.textH7.data|@.bssd@.comment8.filegwrite.s.text\7.data|@.bssd@.comment88.filegatof.c.textp7l.data|@.data|@.bssd@DGROUP|@.filegldexp.c.text8 .data@.data@(.bssd@DGROUP@.filegbiglitpow.s.text9.data@.bssd@.commentP .filegdtop.c.text9.data4@.data4@.bssd@DGROUP4@.filegptod.c.text=t .data4@.data4@.bssd@DGROUP4@.filegltostr.c.text`C8.dataL@.dataL@.bssd@DGROUPL@@_doprnt.bt1_bufsync.bt2_cerror .bt35_cleanup.bt4_filbuf.bt5t_findbuf.bt6_findiop.bt7_flsbuf#.bt8_wrtchk(.bt94_xflsbuf-.bt10abs2.bt11access7.bt125atof<.bt13p7atoiA.bt14D4atolF.bt153brkK.bt166callocP.bt17cfreeU.bt180chdirZ.bt195chmod_.bt205closed.bt215creati.bt226ecvtn.bt23l0fcloses.bt24fcntlx.bt256fcvt}.bt260fflush.bt27Dfgetc.bt28 fgets.bt29 fopen.bt30Lfprintf.bt31 fputc.bt32 fputs.bt330 fread.bt34D free.bt35freopen.bt36dfrexp.bt37fseek.bt38fstat.bt39,6fwrite.bt40(gcvt.bt412getchar.bt42 getenv.bt43|,getopt.bt44,.bt150D6gets.bt46 getw.bt47 ioctl.bt48T6isatty.bt49isnandkill.bt51h6ldexp.bt528lseek.bt536malloc .bt54@memccpy.bt55|memchr.bt564memcmp.bt57memcpy.bt58memset".bt59mktemp'.bt60+open,.bt616printf1.bt62Xputchar6.bt63 puts;.bt64putw@.bt65P readE.bt666reallocJ.bt67sbrkO.bt686setbufT.bt698/sigholdY.bt70E0$^.bt710signalc.bt72/sigpauseh.bt73'0sigrelsem.bt7460sigsetr.bt750sprintfw.bt76stat|.bt777strcat.bt78strchr.bt795strcmp.bt80pstrcpy.bt81(strlen.bt82\strncat.bt83Dstrncmp.bt84,5strncpy.bt85strrchr.bt86t5time.bt877..bt88:.bt89 ungetc.bt90unlink.bt9107utime.bt92H7write.bt93\7getpidF@S@` @n@|@@$@ @(@@,@0@8@4@opterr<@optind@@optoptD@optargH@errnoL@_facP@_fltusedX@\@ @_dtop9_ltostr`C_ptod=_bigpow@_litpow@etextCedataL@endd@_lowdigit_sigreturn___Fp_Usedsigignoreold_tolowerold_toupper_libc__ctype_libc_malloc_libc_realloc_libc__allocs_libc_free_libc__sibuf_libc__iob_libc__smbuf_libc__lastbuf_libc__sobuf_libc__bufendtab_libc_end_libc_environ_libc__cleanup_lct_numeric__fltusedLBP$bUP#2(@.text2 .data@@(P@.bss(@(@.comment"(U.libJU "&$u1".p'1lo/Jq) (Z , , S01111111111111111111111|1w1r1m1h1c1^1Y1T1O1J1E1@1;16111,1'1"11111 1100000000000000000000000000}0x0s0n0i0d0_0Z0U0P0K0F0A0<07020-0(0#00000 000/////////////////////////~/y/t/o/j/e/`/[/V/Q/L/G/B/=/8/3/./)/$///// ///..........................z.u.p.k.f.a.\.W.R.M.H.C.>.9.4./.*.%. .... ...--------------------------{-v-q-l-U@WVjj<@@@=@u-k8Pj@@ u8@jj(@EEh@h Su@ E }uj(@8@말}tލEPhdTjEPu  }uj(@guj(@}(t@7u kE85@(Vuċ ^Vu 0 }VI } u F0<}u.EPhSu@ E  uF0F0E wY.$}^_Ð^_Ð^_Ð^_Ð^_Ð8@2^_U0WVu EuJ u ^_Ã(u8@吐GEEt EEEGEEEuEE;G$vE@G$E!EtE@ E@EE؉E܋EЉEuԍEPEPu$@ }4E9Eu?@8 u8@ 8@E)EEЃ}QG0@G0E+E^_ÐU,SWVu Eu u ^_[Ð{(u8@␐{,tFEPhSu@ E }8@벐}tC8 u8@ 떐C EECEEEEuEEPEPEPu @E }@8 u8@ 0}uE}U}}8@@G} tptttWʐE}t }|{,uu}tEt }t C0@C0E^_[Ð{,kuuuuSEEECEC+EEECCEEEPEPEPu @E H}uE}t#8@@GC,EC#}ut E#}tEE}#USWVu ud u ^_[Ð{(t8@㐐~u 3^_[ÐC$9F~8@@G벐CEFGGFG GE~t GPvjvuGGE~t!GPvuvuGG EC 9E~8@@C EEEEEj~tF3PEPu$@ })@8 u8@ 8@C0q@C0USWVu Eu u ^_[Ð{(t8@␐{,t8@ ΐC EECEEEPFPEPu @E })@8 u8@ x8@i~uF}}}#8@@GF*}t&8@@G}| t G G;E9GwF 9G v8@ 됐}tEwGEPv@ GFw GEPv@ G FC0z@C03^_[uujv SFrFF}tE뭐U}|#@@H9E=@tkE8@u8@3Ð8E@ÐUEMUʉu uEEP@ÐUE 9E~EËE ÐUuu Ep@ uuEp@ EMHEMH E@,ÐUEPhSu@ E }8@Ð}u E x,t 8@ ݐ3U,WVu jju @ Ejju @ $Pju @ EFEF EFEEFEEEPEPEPu @E }@8t8@3^_Ð}t8@@ڐ}}8@@G뺐uju @ }tuƃ}|E9Gu^_Ð}|E9GuuDEPhSu@ E A t8@ 88@(G8@@O UEEEEEE EEPhSu@ E }8@3Ð}t"E8@u@MɉӐ}tEMÐU(Vu ubEu TEPuE t?Pj@E u^uj@E uu@ՐEEu$Eu(EEE0EPj@E u}tu@uuj@E u'}tu@u@uYEFEFEF EFEFEFF FF,fE,F$E0F(F0F43^ÐUEt u Ð3UEfE@E@E@ E@E@E@E@E@ E@$E@(E@,E@0E@4ÐU(WVut u ^_Ð(t8@㐐,tZG EG EGEEEEG,u}| >8@@G널u0E k@t8@WG EEGEEEEEEPEPEPu @E }8@}78@@} toE N9rN 9H s8@ E NHvFEPE p@ E NHv FEPE p@ E N HG0@G03^_U,WVu u EEFEEEEEEPhSu@ E } 0~,u}}E܉E~,t*FE t%}tE8 u}F, EEE w].$P^_Ð^_Ð^_Ð@^_Ð^_Ð8@@G44444(}t }p}t}3^_ÐU=@ } @ =@~ @ @@=D@t u8ZE9=@kE E0h@h@ EE8M@=,@I8h@WDP t3E0Ph@PEh@h@E0 2E0<@J} @yh@@@@%0@%@ @@=@~&j5@E0h@h@E0h]@E0ƀ]@lE8h@WDP~ uE0h@Ph@h@E0w PE0(G @ =}  @_=G }  @)#F=G@}  @]F.=G}  @ψ=G}  @eE0h]@j/h]@E >Eu}jh]@;;s uh@3ME/hh@h]@)= @Ph]@ ƅnh]@hl@h@ =a@urj1 tdh]@h@h@ h@jPjK t$jPj/ }h@9ytQh@h@T9E]@u>jh>@L:;uh@@= @uQh@h@h]@ u h]@m$@=(@uE0h@h@ }t4=,@th@h@x,h@h@琐=,@ub = @Fh]@E0 $@=@t =(@ @yh@j  @@=,@uW}t =(@ @yh@j E @@=@E }h@h@nj8} @yh@@@@%0@%@ @@G=@~$j5@h@h@j8}t g=@t @@P7^_ÐU @yh@@@E @yh@@@E@8Eu@8Eu3Ð@8Eu@8EuÐÐU @yh@@Pg@ @ @ @yh@@P2@ @ @EPEPh@h@1= @u2=(@u)h, @h@PuE+EPh@ E9Ev @Uh@h@&USWV3=@ @yh@@Pi@ @ @ @yh@@P6@ @ @ @y!h@@ 0@P@ 0@ @ @@ t4$@GP@4@8@L@<@' a@Ha@=0@t @ @yh@0@@EE5 @ E|+EE @EP  @yh@@@@ML@ @uM3} @ρ94u#@ρ?HE{ @ρ<|PE+ljE uEE+y} @ρ94t @ρ<uP@]@9@}A@ρ?@@fH @ρ4<@9L@=0@utP@jd= @u:=(@u1h< @h@5L@L@+GPh@M L@9G~ @^_[ÐUSWV54$@=a@8$@}|؁E"T@`@" C+ƉE+M}| EC} tEa@4$@;4$@uL8$@=a@=G @yh@CCP8C @ @Ou4$@a@9@ =4@=4$@~2h@5a@jh8$@{;a@ta@G4$@=4@t* a@Ha@4@^_[Ða@@9a@u @ a@Ha@^_[Ã=4$@~%h@4$@Pjh8$@4$@G4$@h@V@ t^_[ÐUSWV a@Ha@5@ˁ?fH@ˁˈK }ǃ=0@t @E @yh@P8Nj @ @@ taASuQ=0@tH@ˁ?fHK }4@@4@ ]9@ALjF]7@ˁF@ˁ?H؁}Ë@ˁF @yh@NP)N @ @aAwʋ@;@}>@ˁ?fUfH@ˁψC@EE,؃h@@ t^_[ÐUSWVEH$@=4@p@9l@}a@9@a@9@~/a@@9a@u @ a@Ha@=4@~" a@Ha@4@h@5a@jhH$@Tp@  ^_[Ðl@p@+a@@p@=l@a@EEE+ljE+؋|EE E`@# a@l@^_[ÐUSVu] E 8uuF>uE^[Uh]@+h]@|j|,ÐU,h@EPu  t ufEf%f=tJ=(@tuhL @h@ hT @h@@@f}~9=(@tuhx @h@ EHPh @h@ 말=@u/=@@u&=(@h @h@L@fEfEEPu  t u 3*EPEPu * EEԋEE؍EPu u t u)=(@u3u h @h@ Ðu  t u )U=$@u h]@=D@t5H@j*ÐU=,@th @h@/h]@N=D@t5H@7j7*ÐUVL@'<@=L@~"5G u L@L@=G958@} 58@^Ð8@5 @'@4@h^USWVuE3 E }]@MEm}EMHEMHċEMHȋEMH̋EMHЋEMHԋEMH؋EMH܋EMHEMHEMHEMHEMHEMHEMHEMHm@mbG EmEMM}^_[ÐUV} F~E'ȋE E '} }'Eyuj-v-MQAދƹdRƙPh @u^ÐU(h@h @P uP&PP1 |Ѓ=,@=@"E    @yh@~@@@%0@%@ @@=@j5@Ph @h@G @ =}  @^=G }  @)#F=G@}  @]F.=G}  @ψ=G}  @e5H@PPh0 @Ph@h6 @P u 5H@I}t=,@t =,@t6sh@cP tPw$PP$ }(PN$Ph8 @h@ P0jPPPPPPP>$ hP5a@1 Pj$ÐUE8/tx/uuhX$@7 h\ @hX$@%uhX$@hX$@ X$@EEME8/u@X$@ÐUh@h` @h@ h| @h@h @h@jh @h@ÐUEEfEX@E}|EEJ@u M}EE9E|ÐEEJ@E EEJ@uEEE9E|}fEfX@E9E|Ð}~ }ufX@fX@E9E|fX@E9EmÐEfEX@E9EQÐUVEX@u M}uu (EoEEY@EPjuPVE9Eu/EY@u E}|E%PjE9E|^ÐUEEJ@u M}uj tEE9E|ËEEJ@E EEJ@uEEE9E|}8EEE9EXH@PY@Pא}"ZH@PY@PEP9}u6XH@PY@PZH@PY@Pjj;\H@PY@PkEPj EE\H@PEY@P@E9EÐUEEL@PEJ@P ÐUEEE mE}uEEXH@PEY@P}v ff+M#EPEHPÐUhL@hJ@hP@h EEP@EPjd}rXhXH@hY@hX@j Erjjj jjuj b1jjjjjj uj hXH@hY@hxX@jE ErjjjO jjujEEeEtOEEX@P!EEX@EEEX@EuEEX@P='GuuEE9Es$ErEEX@E^EEfEP@E}rEEfExX@E}rU-Y@=Y@uOY@ @;Y@w='GY@Y@Y@Y@X@Y@Y@X@MEfEP@}rdY@X@ Y@Y@Y@X@M Y@Y@X@M Em E} uEfExX@ÐU= @uN @@+ @ +k !"#$%& @=s h @ 5 @X@ tX@EEfEP@E}|EEfExX@E}|3Y@Y@uÐU='GujjjjÐUu fE u\u TEEEƀY@EE9E|EE}EfMf EH@ߐE'G EuEmE'GEu}}EPEEMY@E9Eu$jEEEƀY@MyE9En EEƀY@E9E|hH@jhY@PUj 'E u]j EEEƀJ@E}|EE}'EfMf EX(@ߐE'GEH@E|8E'GEtEEG EEGEm}ϋEY@P}M}u E*}uj+j EMx!EEƀJ@EEMJ@E9E* EEƀJ@}|hX(@j hJ@htÐU=L@uBjL@ uG3jjj 1jjj L@'GEX(@E=r9E'GEtEEG EEGEm=s΋EJ@P@EUV'GEH@Er9E'GEtEEGEEGEms΋EY@P}tuNVgЉUE^UL@UWVE EfDEEЃ}vEEE fDEEЋE9EwfDžvE%ufF*MfftfvEЃ}vf}t h @+EEE'uMfӮtfM*MffFEЋE9EsEf*MffTEEЃ}vEEvME t'MEEEЋMfAE9EuEEff+MEEEЋE9EEЋMfUfAᐋpEtEMEEp+EEZEf8u"uf3fGfGEMEfEEtEEGEEGEeMЃ}uEfMfpfMfEtEE9Ev=E p ttFljEp9E}^_UL]@9E} @|fE ]@Ð @EEGPEEGP @ÐU VEEfE ]@E}~urEEEE ]@ff+MEM}Oh @h@Sf @]@EM}~uf ]@tf ]@f"]@M}uEM}~/EE ]@EMxH]@H]@T]@M^ÐUWVEE Y@EnP]@9E}(u"Y@ D]@ Y@fWf9AsEEE Y@ D]@UfVf9As,EMf M Y@f E Y@EEEE;P]@~EfMf E Y@^_ÐU(VfEEufD5f ]@ffD5E}~E EMU ftUfDUf4AEE9E|^ÐUSWVEL]@E D]@ET]@L]@EP]@f"Y@E9ET]@E D]@f|f} E t]@f]@΀fAq]@5h]@f fEFEEPEPfEf u)]@PEPEP& l]@^Ðl]@f} |fEfE ux]@f0fEt]@fpfp]@f]@f9p]@| f-p]@ ]@l]@h]@Ep]@l]@h]@E*EM 8tEP^l]@EEE;l]@́=l]@}hE t]@f]@fAfEfEEPEPfEf u"]@PEPEP ^Ðl]@E d]@fAfE]@fUfAE @f]@fAE @fAfE]@fUfAE d]@f]@fA]@ ]@fUfAE ]@fAE @f]@fA^ÐU WV]@ ]@fA:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@I/O error or disk full.Error: %s Error: %s: %s No memory available%s: %s %d %s Error@@@@@@@ @4@H@X@l@@@@@@@@@@@(@<@P@d@x@@@@@@@@ @ @<@P@l@@@@@@@@4@P@\@h@t@@@@@@@ @$@0@<@P@d@t@@@@@@@@,@<@H@T@h@t@@@@@@@@0@X@x@@@@@ @<@\@|@@@@@@(@H@x@@@@@@ @<@H@d@|@@@@@@@,@8@D@P@\@h@t@@@@@@@@@@@@@$@4@D@X@d@p@|@@@@@@@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in path ((((( H 0G0G"@0G@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL+  | p|@.textpp p .data|@|@||@.bss @ @ .fka000C".fka040@@LB.fka041L@L@.comment" .lib @@@ @@@ @@$@@(@| @,@ @@ @@@4@0@@8@}@ÐET}@RU RPWh|@jL@ PjUVDž}}h@h@'jEE @EE ȋ HE Mƅ?u qƅ-ƈƅ ƅPPVux:u)5H@Pjh@PVuu u @ht jph@(E @@@@4Ph@P@@9EPh@}j ^Ð=T$"ÐUu1@u3Uu@u3ÐEÐU= @ uÐ @M t @ @3ÐUV5 @Ny^Ðt @Ny^Ðusage: getopt legal-args $* -- %s ((((( H @@| @ @@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL+ 2p\@.textpp2p .data\@\@\4@.bss @ @.fka000C".fka040@@LB.fka041L@L@.comment"P.lib Q@@@ @@@4@0@>@8@]@@4@@8@ @=@$@@(@h@,@l@ÐET]@RU RPWh\@j&L@ Ph1jUSVDžPME DžT EEƅ\E 0>-t1!@}}!@ME FEME E tÃatnctdt}|2}z,EEPh@} }h@ h@h@wÐU}'uh@[Ð}\u h@萐E@WtPh@Vu<E t Ph@ u E@Eh @u uoE(@f}t}u EKuE u9} |}~ك}| }zEE# Ph4@E@EU EEh8@0hl@#EEE=EEE@t#u>E tPuh|@ EE E9E|h@EEE=EEE@t#u E tPuh@w EE E9E|h@[EEEP@Ph@5ujuu E tPh@ h@EE E9E}]ujuu E tuh@uh@ujuu OE QQÐUE EE Puh@cÐUEEEPu uEÐUVuEEEuuVEEt%!@y VY FFE(jWF Ph uEE!@E@t5E} !@VEPMf]mY !@VEPt !@VEP`- !@VEPHEFFMxlE;sL@"3^_[@u}@@tC@t7W+؉EE9E|h}}}6EPZ]}t E]}lE@VWu_^3}t}u EmEEE܋ê!@Vz}R` @;u EE tet E/}%EE ê!@yV FF@g+^-U@CE@EE}t }t]}lt}huE@fMfE@M !@VS@u !@E^_[ÐU SWVu} ] tE@3EEcu u!@Ey u EH@E@t5su E@u$[u EE8u tEMEK }u!@ !@& ~! !@uu0@u !@E9Eu3^_[ t ctE^_[ÐUSWVu} E>^uEFh}PW' E]t-u_EM FS}u 3^_[Ð}-u2E]t'F;]}E+@PuP 붐EM FFE]u^_[ÐU SWVu3ۉ]]]F>@uǃ+t -uEFEEF~@u.uVEE uLF~@t>+]056789:;<=>?} } mE}붐E}  kE ljECM뙐}u@^_[ÐEEEteucEE t +t-uEF>@t3}} kE ǃ0EF>@uރ}t+]]uSuuuG^_[ÐÐUu@PE u3Ðuu}U8SWVu}6~L@"}@^_[Á}}L@"@^_[Ð t}+Ek (@E?##@EE@M EEE؋E@؋EEp +ƉE~EE]3m}ueeEu %?ME%?E޸F+EEE?EEE؋??e?e?.E???3EEE*E u$]EEEm␐E} E |E)EMeeEEE؋E?e?e???+E P+Ek  @E@EE@EEE܋E@E؋E@MMMMMMMMMMMEEEԋE@EЋE@MMM؋EMEE@ E]EEEE?E%?E%?E?#߿?#+E%k (@E@EԋE@E؋EE܋E@EE@MMMMMMMMMMMEEEE@EE@MMM؋EMEE@ EE?E??EEԁ |ME+EE } EE}IEM E̋K EԉE u5 t1E̋Efs"L@"}@^_[Ð}u E^_[Ðuuu ^_[ÐU}tE@uEÍEPu u P@}~B} EE=~TL@"E@s @Ð@Á}| EE=}L@"@uu u2 ÐUVu@t @^ÐUhPu =|hPu =}hPh@S hPh@: 3ÐULVu u3^ÐEPu |fEf%f= uh@E tžuE u$juN uu덐Eԃ8t tM9uh@h"@Eԃ Ph"@EPh"@ wfEf9EifEf%f= W tfEf9EEu "@^UVuv V62^U(WVju } 3^_ÐEPWn |2fEf%f=@u$j thtF u%fEf%f=@t L@W두>3FF^_ø$3ÐUWVuE~t~~ FEGFF9F|3FF~u+hv 6( F  uEF3^_Ð~~ ^_øQÐUVuVp;E tFju 6a F^øH3ÐV|$3O|$ ыt$ D$^UjjE0 u3ÐE@MA E@UVE@ u @ t H uuu E@ t ^Ð^ÐUEEf%Etf=Du]Ð]T$BÐUu1@u3Uu@u3ÐEÐU= @ uÐ @M d @ @3ÐUV5 @Ny^Ðd @Ny^Ðmapkey: input is not a mappable device /usr/lib/keyboard/keysr/etc/default/mapkey/etc/default/mapkeycannot open %s cannot open %s cannot open %s %s, not a mappable device r/etc/default/mapkey/etc/default/mapkeycannot open %s cannot determine the tty cannot open %s usage: mapkey [ -adoqx | -c csxmap ] [keyfile] /dev%s/%s/usr/lib/keyboard/keys/usr/lib/keyboard%s/%s/usr/lib/keyboard/keysrscan code out of range error in value #%d missing lock state %s: %d: NEWLINE expected # alt # scan cntrl alt alt cntrl lock # code base shift cntrl shift alt shift cntrl shift state 0%o 0%o 0%o %3d 0x%02x %3d %c nop %-7sscr%d fkey%d ?? '\'' '\\' '%c' %-7s0%-6o%-7d0x%-5x%-7d@@                  "'#(                  $                                                        !"""""""""" ################%&&&&%%%%%$)$*$*$*$*$)$)$)$)$)######%%%%%%%%%%%%%%%%%%%%))))))))))))))))))))> @4 @@ @@ @@F @$@@ @0@$ @8@ @@@ @H@ @T@ @`@ @ @l@` @ @x@@ @d @@@ @| @@ @@r @@ @ @@@ @ @@ @@ @@@ @ @@` @ @@z @ @@@ @@t @ @4 @@ @$ @@n @ @@b @ @@@ @@@ @@| @x @ @ @v @ @@ @ @@ @ @ @@ @ @@ @ @ @( @@ @ @0 @( @@ @  '0111100088AAAAAAGGGGGGGGGGGGGGGGGXGG'AAAAAAGGGGGGGGGGGGGGGGGXGG4@ bad switch yylook %d@@@@@@@@@@@@@ @8 @7@6@5@4@@ @$@(@,@0@4@8@<@ @@ D@ H@ L@ P@T@X@\@`@d@h@l@p@t@x@|@@@@@@@@lshiftrshiftclocknlockslocklaltraltlctrlrctrlaltctrlnscrbtabcnobnopnulsohstxetxeotenqackbelbshtnlvtnpcrsosidledc1dc2dc3dc4naksynetbcanemsubescfsgsrsnsdelError in file(%s) on line(%d): %imissing character codecharacter code too largefirst char of keysymname must be alphanumericfindstring: strdup failedKeySymNameChar Code%-10s %50-s %-10d %50-s rfile open errorXMP_ParseCSXMAP: calloc of table failedmissing keysymnamecode re-defined with symbol '%s'l@t@|@@@@@@@@@@@@@|@@ @@{@ $@K,@L0@M8@ND@OL@PT@Q\@Rd@Sh@Tp@Ux@VShiftShift_LShiftShift_RLockCapsLockCaps_LockNumLockNum_LockScrollLockPauseMod1Alt_LMod1Alt_RControlControl_LControlControl_RSelectHomeUpPriorKP_SubtractLeftBeginRightKP_AddEndDownNextInsertblankKP_%speriodKP_DecimalminusKP_SubtractplusKP_AddasteriskKP_MultiplyslashKP_DivideequalKP_EqualcommaKP_SeparatorReturnKP_EnterF%d; DO NOT MODIFY!!! USE 'mapkey -c' TO GENERATE ; [modifiers] %d: %s [keyctrl] %d: %s [keysyms] %4d: XK_%-20sXK_%-20sXK_%-20s GG  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~/dev/ ((((( H @:'i _;?U3R)E?98p)D5} [%/ -I /wb5,6)6d>n G79 85q&5 1Z$.H+jt'!]6$J !5w%^_KLza N } dP@fff&h&QG!+ A j<h"2S58C7{-_k2+/4 U# >D K) m5\W?YU }?^Fz !%ph]( ZJ(9H/9Y!,=@=@h@=@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL+  vL6lp@.textpp vp .data@@L6w@.bss=@=@l.fka000C".fka040@@LB.fka041L@L@.comment"ܭ.lib@5@@ @@42@4@0@HY@8@@@PO@@XS@ @`W@$@8@(@\<@,@`<@ÐET@RU RPWh@jFL@ PtjU(S}}r h(h<J@ uh` @h8@j KtH@EM E E EEE t5@ufuEf tME#E5@tE؋ME @E؃} |׋EEƀ@=Eƀ@h @h@:h@4@ u(H@@H@H@E E EE E H@E E H@ O@N@m4O@aN@UO@IO@=O@O@E E H@ O@E E 0d3@$O@E E 0|2H@H@=O@th5H@N@ }5H@hX@5L@83 hN@5N@fN@ftH@fN@fLO@=(O@t=N@t5@h@Tu &=N@h" @5H@ u0jiJN@=@th,@j2 O@j5H@kN@ =(O@t=N@th8@h@u KU=N@tsh$ @5H@n u0jIN@=@th,@j1 O@j5H@N@ uu O=O@t3hH@2hH@5H@2h& @5H@5@ [ÐUh8@h( @h8@hP @Eh @PwPmEE h1E } j . E'E0@@=h@+ uNEE9Eƅ } |‹E 0@E0@@=ˆ롡H@ H@=H@t @ @P5H@5@5H@P@Ph @uN EEE E:E}th8@P?jÐUSWV=O@=,O@t5@ t}%=H@h@h@h@h@h@h@h @,P 5H@},Pc5H@hT @h@ hN@H@@ P{N@|H@H@hhJ@o=H@tc=@tH@=@ thX @j.-H@=N@t+@@PH@Ph @5@5H@u%f=,O@ug >/uF>u;t+SD }Sh @h8@i /GjWS[ hJ@ & u= =H@t%E@PhD@u!uhL@uua=O@u$j\EN@EEPu[u=O@t3N@PN@Pu3 N@%PuEPu@uh`@h8@}u4@f#N@fMf;tuh@h8@ Eȃ}_h@uEPu2B=@O@th@jjh@ =O@t jE9E~#E+EPh@h8@ @ÐUE^P}~huPu E }hH@h@5L@ m ÐU|WVjdhH@EPX EE5H@EPh@h8@ =H@t25H@h,@ytu^_ÐH@E5H@N@E=N@t1@Pu5H@EPh@0uuEEEF9uhH@h=@Hg uh@h8@Bj  U8 t,h@h8@EPVh@h8@ th @95H@V5H@hD@h8@h@h8@aiuN@E=N@t1E@PuuEPh@^_ÐUjdhH@h=@? h I@h@>@ h(I@hH>@ u}h0I@hP>@ ughDI@hd>@ uQXI@8x>@uDjdhYI@hy>@ u,hI@h>@ uhI@h>@z tÐ3U H@=H@t= O@u @3EE5H@u:E u=O@t E9E.5H@u E uhE=N@t hN@hH@h@M=H@tm=N@tK5H@5H@5H@h@C#E}t[hH@ua ty5H@5H@h@ =XI@1uhYI@h(@h6@=O@t jpE9E~#E+EPh8@h8@ @UWVu2E;wP N ^_ÐUWVu=O@t52E;wN ~hPhH@ ^_UVuVuF PFPhT@5@vh`@5@ FP.Phh@hEP+EPhx@5@ ^ÐUV( @L @r^ÐuvL @r^UWVu~E @#;u O 6h@5@6 ^_ÐU(WVu?/u(%=O@tN@PN@PV+ /G?tA?/uEPV }hVy-E tVh@5L@N^_Ujjk,O@KLMNOPQRSTUVWXYZ[\]^_`abcdefghijklÐUjjS,O@ÐUjj;,O@ÐUWVuH@GJ@rF%Ph@h I@ FPh@h(I@ F Ph@h0I@ vh@h8I@ vh@hDI@ =@O@t ~tI@1^_ÐUWVPI@ GXI@r3H@ GJ@r^_U=4O@tLuh@5@W =N@t hN@ u h@5@+ yuÐ3UVh8@ 8@yh8@j8@8@ t/ 8@yh8@=8@8@ t Ԑn5@t  4@^Ë^ÐUl5H@5uE } Ðju5H@e EPEPh@5H@%5N@9E|3UV=H@tsbGH@ @5N@=O@t@hH@hH@5H@h@5H@hH@"h@h8@~jjh8@ 8@yh8@8@8@ t=,O@uuj빐=,O@t jh@5H@ ujO)#=H@t3P5H@bN@ }/5H@=H@t@ @Ph(@5L@2^Uj=H@tK=O@tBH@+H@P)@98O@}-=H@t8O@ tjj=8O@QÐUh@9uHJÐUWVu} >u?t?/^_ÐFG8Ft3^_Ð^_ÐUSEP,2FE uojfu'jh@@hD@E jhP@hT@wE L@Ehd@h8@Khx@uyI}uh|@5L@EPIE;Etuu}u jE HPuu ~=E E@EE t EE uE8 tuh@jN0 EuO[ÐUV3FE<0t<0 u5|H@5xH@Vu E^ÐUWVN@E9E| ^_ÐE+EEd,E9,},j,5H@ 5H@hj8PN@3,F} 58 uE9,e,(F}(58 uu u=8P: },E ~(E,^_ÐUSWVu} > t j=G38Ds ^_[ÐC9]~8Dv| u 3^_[Ð^_[ÐUVEH@8O@;@E8O@^Ð@98O@~8O@E+@8O@E@8O@E t9u|0)ujE P5N@ @uh@5L@  t:@ P5J@5N@ }h@5L@s 58O@^ÐUWVH@@98O@} =@=@t = O@tv=@ E3uJ@P5N@ E;Eto }eL@Eh@ EL@h@zu uE)E뛐=H@u }=@th}uʋ 9Euuu=@ƹ th@h8@jƙ=N@t*t%=H@uh$@h8@njJ=N@t=95@t5t0=H@tFPhL@Vhd@h8@ 5@8O@@8O@8O@ J@Pu=O@thuhH@l ^_UH@@@98O@|u8O@8O@ J@P^@98O@|ÐU=@~ =H@tvj@ P5N@ 8O@ H@@ P5J@5N@ h|@5L@ j@ P5N@D ÐU=8O@=H@t@98O@~8O@=H@t8O@@ P5J@5N@ }h@5L@=O@t/=H@t 8O@@ P5J@hH@ 8O@USWVu} GFKu^_[ÐU(VEL @} =P @t.=T @tj5T @5P @ ?@?@^Ðh@u P @ uu hX@5L@ EPP @@ PfEf%f=tu h@j ?@?@?@T @=N@EEmuy?@ t}2}P?@?@^5P @uj5?@9Etu h@5L@K ?@?@E?@?@5?@ > uF95?@wE9Et @T @^Ð5P @8^ÐU=P @t}?@9?@s(?@E?@?@8u?@EÐ5P @hh?@ t,h?@E ~?@ uƀ?@?@ÐL @L @USE0|9~h@h8@jmu,E uH@3[Ð}}Iuhh@h8@B=$O@uh@h@h @h8@jH@H@E [ÐUuE Cjh@@h8@ = O@uh@h@hd@h8@j{EÐUh@$ t3Ðjj'@uh@h@h8@K uDE uh@uh@h8@륐h@u8H@ uh@uh@h@j`8E uh@uh @뢐u@h@@j(8E uh@uhD@guH@hx@j7E t8nt8Nu3 =H@H@jÐU=X @hC@%@u L@Eh|@@u1=A9C@t t#GL@Eh@ u<5C@u5C@j<5C@OX @h@u\ } EEƄ E}|ƅhP5C@G EP;E;C@tu5C@\ @3=N@tC@dP5C@h@S C@C@ dPC@dP5C@ }C@dPh@%uU tehC@ uuh@ÐC@ \ @C@\ @uPuC@dPfE f%f=uU}tOEEƄ E}|uPhP5C@ ÐUuh@EPL jEPh@h@e6L@Eh@uy:ÐUtEEPEEEE&}}%E9EsEEME LEE8/uՃ}u+EE8/tE9ErEx/u)EED/E8/uEEME LE9ErEDEPu^Uuuuuu u&Uh @h8@,uuuu uh8@h&@h8@@ÐUEh@ t ÐE:uh(@h0@EPEP t E9E}EE}c|j EUVu3F^ÐUSWVu } ~!E8EXFF؋O EX^_[ÐUWVu~fF^_ÐUE PE ph8@uÐUWVuƹ ;t3^_ÐjVP t^_ÐUVu u ^ÐV3^ÐUC@|ÐU=C@uyL@Eh4?j C@u uE=C@|tC@0U tL@E5C@j EL@=C@|tEÐu uC@ÐUVT@=L@|@9L@} L@4\@}tE8tPh@@h8@j 5L@VT@u H@P@Ph8@>^ÐUWVj*ju 3U}#E kME 8GE5@u؋E8u3^_Ð t t5$EE8_u F}/3뼐Ex.t ^_ÐFܐEE8.t䐐^_UWV3%kE<8ujE PEPo F|^_ÐUjh*@jw u 5Pu j^ jh*@jM E.$\BE *@u Pu j j"h*@j jh*@j jh(@Րjh+@jο jh(@j轿 j h+@jh(@j袿 jh+@륐jh(+@낐jh@+@sj hT+@gAAAAB8BDBDBjhb+@jBU4hd+@u uE*@uu t ÐE8txt x>u (0E t1EPub tu j5EPuE8txt xhh+@/E t0EPu tu jEPuE8txt xh(@ t$E8uxu xu jEh(@E EPui tu j<}t}t}t܋E8tEPuU tvExtEPEP% tFExtEPEP tEPuOE}jP}u u j]E8t xtxu EPh*@TEPu3ÐU=0*@|50*@)}t ju޻0*@ } Ð3Ujj50*@臻 Eu EhhD@50*@蟻 E ~3ED@EEE8 t EM}u}u2}D@u3Ðju50*@ }tEEÐEE+E@Euuuu tME@EwUVEPkEH((@u , t3^hp+@EPE-h~+@EPjkEDPEP, E}|h+@EP躺kEHh(@EP褺jEPA|@u)}tkEH((@j6Q+@^jEP| |kEHM8d(@t(kEH((@j||kEH\(@E|Ӹ}tkEH((@j^kEH,(@jEPV+ h+@kEH,(@P裹jEPkEH,(@P+ h+@kEH,(@PtjEPkEH,(@P_+ HE,(@^ÐUWVEEE@} }3gE@^_Ðh+@hE@kH,(@PhE@ܸkHp(@t!t(@P,(@P¸ tEFkH((@u}t,(@^_Ð3kHE9$(@u ,(@^_ÐFkH((@u3^_Ð}hu hE@` F@=E@/uEEE@EE@3juV E tF}u$}t*EEj/P!E tEkH((@uE ^_Ð3FkH((@DkHM9$(@uju VJ ^_ÐUV}|+EERkH(@^Ð+@^U}uuj t3ÐU츋+@ÐUhD=ht =`3@u"hdH@ThdH@ @`3@32@2@ >l2@hl2@52@Vw >@2@ tCl2@-p2@hp2@52@VC >;t>,u15`3@V^Ðh2@52@脦p2@^USWVu} 3+5@u+>-t&>+t!>;t>,tC }F>u C|3ۀ>- u>+uFuV tE^_[ÐUWVuu  u2@VWw2@_^VWw2@_^2@G'GPFV>,uGPFV^_UWVu} k 0F5@u^_UWVuE5@tEPViE>:u.EPFVkE<>:uEPFVk}}tE 8^_ÐU VEJ0|994EPuE}|}lE MHE @E x|2E8.u*EPEuE}|} E MHE8/uu EuEE^ÐEPEuE}|}mzE MIaEPEuUE}|}4E kMIH}5u E @l}$}5E @ 3EPEuEMEE ~  E4<2@MyE8.u9EPEuE}|}kE}u E4<2@ E NH^McW_UVEl2@ `3@sF9E9E|^Ð3^Ð*L$Q3ÐUVuVAjjF P財 FFf F tf ^ÐUE EE Puh8@cÐUEEEPu uEÐUVuEEEuuVEEt%hH@y V艛 FFE(jWF P蘜 uEEhH@E5@t5E} hH@VEP?Mf]mY hH@VEP hH@VEP- hH@VEPEFFMxlE;sL@"3^_[5@u}5@5@tC5@t7W+؉EE9E|h}}}6EPZ]}t E]}lE@VWu_^3}t}u EmEEE܋êhH@V誙}RT=@;u EE tet E/}%EE êhH@yVH FF5@g+^-U5@CE@EE}t }t]}lt}huE@fMfE@M hH@VS@u lH@E^_[ÐU SWVu} ] tE@3EEcu uhH@Ey u1 EH@E@t5su E5@u$[u EE8u tEMEK }ulH@ hH@& ~! hH@uu @u lH@E9Eu3^_[ t ctE^_[ÐUSWVu} E>^uEFh}PWW E]t-u_EM FS}u 3^_[Ð}-u2E]t'F;]}E+@PuP 붐EM FFE]u^_[ÐU SWVu3ۉ]]]F>5@uǃ+t -uEFEEF~5@u.uVEE uLF~5@t>+]0} } mE}붐E}  kE ljECM뙐}u3@^_[ÐEEEteucEE t +t-uEF>5@t3}} kE ǃ0EF>5@uރ}t+]]uSuuuC^_[ÐVt$T$ :t#t:tt:tt :tu3^ËH^ÐU8SWVu}6~L@"}3@^_[Á}}L@"3@^_[Ð t}+Ek 7@E?##@EE@M EEE؋E@؋EEp +ƉE~EE]3m}ueeEu %?ME%?E޸F+EEE?EEE؋??e?e?.E???3EEE*E u$]EEEm␐E} E |E)EMeeEEE؋E?e?e???+E P+Ek 6@E@EE@EEE܋E@E؋E@MMMMMMMMMMMEEEԋE@EЋE@MMM؋EMEE@ E]EEEE?E%?E%?E?#߿?#+E%k 7@E@EԋE@E؋EE܋E@EE@MMMMMMMMMMMEEEE@EE@MMM؋EMEE@ EE?E??EEԁ |ME+EE } EE}IEM E̋K EԉE u5 t1E̋Efs"L@"}3@^_[Ð}u E^_[Ðuuu ^_[ÐU}tE3@uEÍEPu u- P@}~B} EE=~TL@"E3@s 3@Ð3@Á}| EE=}L@"3@uu u ÐU SWV}u pH@E u3^_[u V{?tu W* u pH@ CpH@^_[ÐUSWVu} C;t8u;t^_[F~u3^_[ÐUSWVu ] G?t8u?u +E^_[ÐC;tې$ÐUE u&juh4@h4@h3@qjjjEjjEEPE;Etuujގujю}uEËEÐD$Pt$Ð5@t$ t$  Ð;%t3ÐUSWVu@ u 3^_[Ð;tsV t^_[ÐUWVu} G8Gu F~=u^_À>u=t3^_ÐV|$3O|$ L$Oϋt$ +D$^ÐUVu5@t  4@^ÐUhPuL =|hPu. =}hPh5@ߌ hPh 4@ƌ 3ÐUVuv ;V26^U(WVju蒌 } 3^_ÐEPW |2fEf%f=@u$j7 th$F u%fEf%f=@t L@WW두>3FF^_UWVuE~t~~ FEGFF9F|3FF~u+hv 6( F  uEF3^_Ð~~ ^_øQ\ÐUVuV(;E tFju 6) F^UjjE0 u3ÐE@MA E@ø<܉ÐUVu }u ^ÐF tF9FwF9Fu߃>uF~u V觉NFME^øpL$tÐUEEf%Etf=Du]Ð)T$ÐUu1@u3Uu@u3ÐEÐU==@ uÐ=@M X=@=@3ÐUV5=@Ny^ÐX=@Ny^Ð8@/tmp/tarXXXXXXarchive/etc/default/tarstandard output archivestar: suppressing absolute pathnames cannot read blocked standard input archivescannot open: %sr-w-@s@xS- r-w-sxS-r-w-txT-h@x@@@@@@@ @tar: cannot allocate physio buffer =tar: %c: unknown option Missing filenamesBlocked tapes cannot be updateddevice argument requiredblocksize must be multiple of %d.'S' option requires 'k' option.tar: warning: 's' option results are predictable only with 'c' option or 'x' or 't' option and 0 'file' arguments -wwcannot create temporary file (%s)!!!!!/!/!/!/!/!/!/! 000 -can only create %scannot create blocked %s-- Usage: tar -{txruc}[0-9vfbkelmnpwAFL] [tapefile] [blocksize] [tapesize] files... Key Device Block Size(K) TapeNoYes %c%-6c %-17.17s %-7d %-10ld %-7.7sPATH=/bin:/usr/bin; umask 077; sort +0 -1 +1nr %s -o %s; awk '$1 != prev {print; prev=$1}' %s >%sX; exec mv %sX %srVolume size not a multiple of block size.Volume ends at %luK, blocking factor = %dK tar: cannot chdir to %s tar: Missing links to %s %o%o%o%lo%lo%o%o%o%lotar: directory checksum error %s %s tar: directory nesting too deep, %s not dumped tar: could not stat %s tar: could not stat %s tar: %s is not a file or a directory. Not dumped same as archive file: %sUnable to open directory: %s tar: Cannot search directory %s: Permission denied ....Unable to reopen directory: %s /tar: bad directory tree tar: %s: pathname too long %6oseek = %luK a %s link to %s tar: Out of memory. Link information lost file too large to fit on volume: %sseek = %luK a %s %luK %lu tape blocks %6otar: Interrupted in the middle of a file %s: file changed size tar: %s needs unusual number of volumes to split tar: %s not dumped %o%lotar: large file %s needs %d extents. tar: current device seek position = %luK %lo%o%6o+++ a %s %luK [extent #%d of %d] tar: %s: file changed size tar: aborting split file %s a %s %luK (in %d extents) tar: %s: cannot link %s linked to %s tar: %s - cannot create tar: ignoring bad extent info for %s x %s, %lu bytes, %luK %lu tape blocks tar: cannot stat extracted file tar: warning - file permissions have changed for %s SENDaNULLtar: %d file(s) not extracted %s: HELP - extract write errortar: %s split across %d volumes tar: first extent read is not #1 OK to read file beginning with extent #%d (y/n) ? +++ x %s [extent #%d], %lu bytes, %luK tar: misplaced end of volume tar: first record is null tar: need volume with extent #%d of %s tar: first file on that volume is not the same file tar: extent #%d received out of order tar: should be #%d Ignore error, Abort this file, or load New volume (i/a/n) ? x %s (in %d extents), %lu bytes, %luK %s [extent #%d of %d] %lu bytes total [extent #%d of %d] linked to %s tar: %d file(s) not found %3d/%-3d%7lu%b %d %H:%M %Y %s %ccannot make directory %s!%6o %6o %6o %11lo %11lo %c %s: %s %lo tar: please insert new volume, then press RETURN.-outputinputcannot reopen %s (%s)pwd/bin/pwdpwd/usr/bin/pwdtar: pwd failed! / No process to get directory name!Directory too long: %s ...device seek errorread error while skipping filetape read errorreadtar: tape blocksize error tar: Cannot update blocked tapes (yet) tar: buffer size = %dK tar: blocksize = %d tape read error after seektape write errorrnot a regular file: %serror reading %star: invalid archive size. tar: sizes below %luK not supported (%lu). bad size entry for %s in %s. tar: invalid blocksize. (Max %d) bad blocksize entry for '%s' in %s. tar: error setting parameters for %s. tar: missing or invalid '%s' entry in %s. tar: '%s' entry in %s is empty! tar: block component missing in '%s' entry in %s. tar: size component missing in '%s' entry in %s. pipeforkSENDaNULL%s: cannot create link%s linked to %s malloc failed. Link information lost for %s-dP %dcompress/usr/bin/compressexecltar: archive%s%d%u %ld%s: %s %d %s Error@@@@@@ @<@P@d@t@@@@@@@@@@$@4@D@X@l@@@@@@@@@@(@<@X@l@@@@@@@@,@P@l@x@@@@@@@ @ @( @@ @L @X @l @ @ @ @ @ @ @ !@!@,!@H!@X!@d!@p!@!@!@!@!@!@!@!@ "@$"@L"@t"@"@"@"@#@$#@<#@X#@x#@#@#@#@#@$@ $@D$@d$@$@$@$@$@$@%@<%@X%@d%@%@%@%@%@%@ &@&@0&@H&@T&@`&@l&@x&@&@&@&@&@&@&@&@&@&@&@&@'@$'@0'@@'@P'@`'@t'@'@'@'@'@'@'@'@'@'@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in path/etc/default/langLANG=4*@english_us.asciishJ@*@H*@english_us.asciiRRT*@\*@english_us.asciiKKd*@l*@english_us.asciitJhJx*@*@english_us.asciiJK*@*@english_us.asciiDKK*@english_us.asciiLC_CTYPEctypeLC_NUMERICnumericLC_TIMEtimeLC_COLLATEcollateLC_MESSAGESmessagesLC_MONETARYcurrencylibc: setlocale: : LANG environment variable syntax errorunable to open no line in syntax error in cannot open locale filecorrupt locale fileunknown error CLANG/usr/lib/lang//_./      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~yn-$ +29AKT[dhlptx|%m/%d/%y%H:%M:%SAMPM%a %b %d %X %Z %YSundayMondayTuesdayWednesdayThursdayFridaySaturdaySunMonTueWedThuFriSatJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberJanFebMarAprMayJunJulAugSepOctNovDec%cdeHIjmMSUwWyYaAbBcpxXnthrTD %I:%M:%S AM%I:%M:%S PM%m/%d/%y%H:%M:%STZrGMT GMT t2@2@' ` / w / : /  M w /Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecTZGG/bin/shsh-c  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ ((((( H @:'i _;?U3R)E?98p)D5} [%/ -I /wb5,6)6d>n G79 85q&5 1Z$.H+jt'!]6$J !5w%^_KLza N } dP@fff&h&QG!+ A j<h"2S58C7{-_k2+/4 U# >D K) m5\W?YU }?^Fz !%ph]( ZJ(9H/9Y!,pW@pW@\<@xW@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sL%+ R*pl@.textppRp .datal@l@*lT@.bss,/@,/@.fka000C".fka040@@LB.fka041L@L@.comment",.libN@`&@4@0@O@8@m@@E@@I@ @ M@$@)@(@-@,@-@@ @@%@ÐETm@RU RPWhl@jo5L@ PxQjUSWVh@lEE 3@h@u uN @toƃ?t@St3Tux@h@:h@:H@뫐E룐53@h@h *@ jPz t;u"53@h@h *@x jPEP5x@S Ett, tJkS53@h@h *@,jDP53@h4@h *@ j"PS53@hP@h *@jO }@@9EE @@@@Ehl@P u ht@ur u ph|@uR uPh@Bu uuF PIO#j(d3j vdF |dp$p ppppp pp0h@hP`90dE@@h@P} ujZh@ub u?h@uF uPh@dWu9 h)@hPR jN^_[ÐU SWVu3V |+^_[ÐV؃|Sh@>3^_[ÐVE@}u ^_[Ð3E @@|@@@G@@9E ~0E @@4 tċE @@4뺐 tX5@5@5@5@5@5@5@5@5@5|@u,P!u됐V53@h@h *@jL^_[UVuFFa&@u3^Ð>u^ÐUWVu3l@@ ;3@~W^_À>$uK~.t>/t>*t a&@tF␀>>uFF>u^_USWVuEMf!} 97} ߃?}EfKf ^_[ÐUVl@fxu3^ál@8tx0tp0,/ )@yh)@j  *@*@l@x8t p8+h)@h@l@8l@@;ˡl@x0tp0/ )@yh)@j ? *@*@^UWVju }:u53@h@h *@\^_ÐWP *@Ps hPV V^_UVEPhTVL @tWEPhTV2 @t=3EPhTV @t&jh0@JEPhTV @u @E%@3@l@xt0f@f @f ,@f l@f H@ff!EEP5@h@l@p0P;EP5@h@l@,PEP5,@h0@l@p`qPEP5l@hp@l@FPEP5H@hL@l@@Pl@@t 8u l@fxueMEPhTV l@PtPAE=t@tl@t l@t=t@tl@t l@t[=t@tl@tl@t=t@tl@t l@tl@x0t p0, )@yh)@j { *@*@h)@jd<^ÐUt@Sj|h3@ tC[Ð3@[ÐU*@t0 )@x*@M*@Ðh)@EPÐL@ Uh juVUh uÐl@rtnQhTlPD +ÐUSWV]Cs;u;tu ^_[Ð^_[UDSWV}h@E} E8h@EDž} Eh@{>uVǃ=f@ VPP/FEF/FuVjP:=L@ |Uh@PXPNEFuV.jPr=L@ f@Bjh@f@f@} EuhD@hP3 >f@~f@[3@S8SSSSSDž=|@hl@=l@j&p@=p@\j>t@=t@-hx@=x@c5t@5p@5l@f@}W @PA I|@l@9@p@h>@t@>@x@>@x DžL4@@#=x@>@5x@%} Ejul@P l@ƀl@ p@l@ t@l@ x@l@l@ǀl@ l@} u E l@fM fl5l@l@fǀ@l@ l@@l@ l@Bl@ l@Bl@ l@l@ƀl@ǀl@ l@l@ l@j4jl@P l@ l@Vnf^SV p@%5p@%C9 $F9+PjVB C=t@t@<JS9' f ff9+%PhW Phju L @;.!t@ffHt@ffh@h@-t@ffH,t@ff=x@x@OS9,9+%PjW S l@$<l@fjl@xx@x@ x@ j5p@5l@n j5t@l@PU hD5x@l@(P9 l@Lx@Dž K@l@ D@ pl@4l@t@fx*l@xl@fx t@f@Džh@<(04_l@ D@ l@ǀDž@m(048E4l@vl@ D@!3l@ l@I\tl@ l@Ihxl@ l@Ix|^_[UE+ɉfffffhjPPál@tQhTlP +Ðl@nQhTlP +h@h *@_hD@@4@h *@? h@h *@-ÐUS]p@Ejj%hL@h @SE@u [ÐEE[US]t@Ejjh@hP @SJE@u [ÐEMA[ÐUS]x@Ejhkh`@h @SE@u [ÐEM[U SWV],/@+E EEEl@E u +^_[Ð,1@ %t LjF `C{ƅ%\:uC{Dž+\\ψC{Džx w.$@$$$$$$$$$$$ DǃXt t tt \\ψ\PV| F>u/ tt)t$ DžFt l@@T l@@lXt, t(l@HI;~xtt@tXXtl@M9HPyXh,1@[`XPEE5C{M`M␐MΐM뺐M릐M 뒐M${M(gM,S1.$4H\pǃ1؉;ar;zw`/;A;ZMf`fA>C;ar';zw" `ϐ;A;Z~ UJ>ƐCK`C{'={DžE;-u EC#;+u9 ǃ0C{0}ۃ}%E``@``@+V``@'``@``@`p``@#B``@ ``@3``@+σc``@9F``@9```@t uXDŽ`P``@u tDŽ``ى```jeSj; ^.$%H%" "t!!@"@'<$##@'$$$ `#% " %!#h%C{ Kh,1@V8,/@^_[ÐUSV]+/<%u*CE:E t<;u u ^[Ð}?uF};uNCE u+^[ÐU SWV]+uul@ 1@9H,t9uEa&@tCCxyz{|}~ 0a&@u;.u$Ca&@t @Ca&@u;/u E ;*u EC␃}tE ;>u C u(GGPU^_[Ðl@xt }u^_[uV됐US] t;1@.;$u{u E t1EPub tu j5EPuE8txt xh@5E t0EPu tu jEPuE8txt xh@@ t$E8uxu xu jEhT@E EPui tu j<}t}t}t܋E8tEPu tvExtEPEP tFExtEPEP tEPuOE}jP}u u j]E8t xtxu EPhT@TEPu3ÐU=h@|5h@}t juh@ } Ð3Ujj5h@ EuEhh1@5h@G E ~3E1@EEE8 t EM}u}u2}1@u3Ðju5h@4 }tEEÐEE+E@Euuu tME@EwUVEPkEH`@u , t3^h@EPE-h@EPjkEDPEP E}|h@EPbkEH@EPLjEP|@u)}tkEH`@j6Q@^jEP| |kEHM8@t(kEH`@j||kEH@E|{}tkEH`@j^kEHd@jEPV h@kEHd@PKjEPkEHd@Pz h@kEHd@PjEPkEHd@PK HEd@^ÐUWVEE2@} }3g2@^_Ðh@h2@kHd@Ph2@kH@t!@Pd@Pj tEFkH`@u}td@^_Ð3kHE9\@u d@^_ÐFkH`@u3^_Ð}hu h2@ 3@=2@/uEE2@E2@3juV E tF}u$}t*EEj/PE tEkH`@uE ^_Ð3FkH`@DkHM9\@uju VJ ^_ÐUV}|+EERkHP@^Ð@^U}uuj t3ÐU@ÐUhD=h=u ^_ÐFG8Gt3^_ÐUE EE Puh)@cÐUEEEPu uEÐUVuEEEuuV5EEt%3@y V FFE(jWF P uEE3@Ea&@t5E} 3@VEPMf]mY 3@VEP 3@VEP- 3@VEPEFFMxlE;sL@"3^_[a&@u}a&@a&@tCa&@t7W+؉EE9E|h}}}6EPZ]}t E]}lE@VWu_^3}t}u EmEEE܋ê3@V}R.@;u EE tet E/}%EE ê3@yV輺 FFa&@g+^-Ua&@CE@EE}t }t]}lt}huE@fMfE@M 3@VS @u 3@E^_[ÐU SWVu} ] tE@3EEcu u3@Ey u襹 EH@E@t5su Ea&@u$[u EE8u tEMEK }u3@ 3@& ~! 3@uu @u 3@E9Eu3^_[ t ctE^_[ÐUSWVu} E>^uEFh}PW˹ E]t-u_EM FS}u 3^_[Ð}-u2E]t'F;]}E+@PuPj 붐EM FFE]u^_[ÐU SWVu3ۉ]]]F>a&@uǃ+t -uEFEEF~a&@u.uVEE uLF~a&@t>+]0} } mE}붐E}  kE ljECM뙐}u%@^_[ÐEEEteucEE t +t-uEF>a&@t3}} kE ǃ0EF>a&@uރ}t+]]uSuuug^_[ÐU}u3jEhJj EEE}t7E9Ev )EE'E+EEEEEMuj h3@ uuemjVE}| ujT } }}}tEEPEEUjh3@EÐÐÐD$Xpxh Z`P+␋T$D$;j t Zrzj bu@bU8SWVu}6~L@"}$%@^_[Á}}L@",%@^_[Ð t}+Ek l(@E?##@EE@M EEE؋E@؋EEp +ƉE~EE]3m}ueeEu %?ME%?E޸F+EEE?EEE؋??e?e?.E???3EEE*E u$]EEEm␐E} E |E)EMeeEEE؋E?e?e???+E P+Ek d'@E@EE@EEE܋E@E؋E@MMMMMMMMMMMEEEԋE@EЋE@MMM؋EMEE@ E]EEEE?E%?E%?E?#߿?#+E%k l(@E@EԋE@E؋EE܋E@EE@MMMMMMMMMMMEEEE@EE@MMM؋EMEE@ EE?E??EEԁ |ME+EE } EE}IEM E̋K EԉE u5 t1E̋Efs"L@"}%@^_[Ð}u E^_[Ðuuu ^_[ÐU}tE4%@uEÍEPu u} P@}~B} EE=~TL@"E4%@s <%@ÐD%@Á}| EE=}L@"4%@uu uR ÐUE u&juhX%@hT%@hL%@qjjj?Ejj0EEPE;Etuujuj}uEËEÐD$Pt$Ð5m@t$ t$  Ð;mLt3ÐV|$3O|$ L$Oϋt$ +D$^ÐUhPu( =|hPu =}hPh`&@軮 hPh\%@袮 3ÐtÐUVu }u ^ÐF tF9FwF9Fu߃>uF~u V?NFME^øL$tÐUEEf%Etf=Du]Ð0SNL$0S:L$0+L$0L$0 L$0_ÃMT$2ÐUu1@u3Uu@u3ÐEÐU=(/@ uÐ(/@M .@(/@3ÐUV5(/@Ny^Ð.@Ny^Ð2Kn,X` %KPdd 2  dTERMST:LINES=COLUMNS=usage: "%s [-ST term] capname [tparm argument...]" %s: No value for $TERM and no -T specified %s: unreadable terminal descriptor "%s" %s: no terminfo database %s: unknown terminal "%s" initresetlongname%s %s %s %s %s %s %s %s %s %s %sinitresetlongname%s %d %s: unknown terminfo capability '%s' %s: Cannot open initialization file %s. /dev/ttyunknown @<@9@h>@>@>@TERMTERMINFO/usr/lib/terminfo/a//usr/lib/terminfo/.LINESCOLUMNS#$" !+,&/usr/lib/terminfo is unaccessibleI don't know anything about your "%s" terminalcorrupted terminfo entryterminfo entry too longTERMINFO pathname for device exceeds 512 charactersmalloc returned NULLterminfo file for "%s" terminal is not readableSorry, . @@@.@G@_@@@#   $ "!    2  0bok p r3i4cj`% .-/ l43n5m+, 601279:O=SW;<@?ABCDEFGH    IJKLVMNTPQRU>8Z[\]^_`abcd1vwxPJOIQKRMHLg*)hhstuN!\~]y"}qAB&()C*Xeeg+,z{|DEFG@Zji-S[6/.'78TUVWXY9Yfdf#$:;<=>^?_5 !"#$%&'(abwamxsbxhpxenleognhckmhsindadbmirmsgroseslokxthzulxonnxonmc5ichtsnrrmcnpcndscrcccbcehlsxhpacrxmdaisyxvpasamcpixlpixcolsitlineslmxmcpbvtwslnlablhlwmawnumcolorspairsncvbufszspinvspinhmaddrmjumpmcsmlsnpinsorcorlorhiorvicpswidcscbtbelcrcsrtbccleareledhpacmdchcupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdch1dl1dslhdsmacsblinkboldsmcupsmdcdimsmirinvisprotrevsmsosmulechrmacssgr0rmcuprmdcrmirrmsormulflashfffslis1is2is3ifich1il1ipkbsktbckclrkctabkdch1kdl1kcud1krmirkelkedkf0kf1kf10kf2kf3kf4kf5kf6kf7kf8kf9khomekich1kil1kcub1kllknpkppkcuf1kindkrikhtskcuu1rmkxsmkxlf0lf1lf10lf2lf3lf4lf5lf6lf7lf8lf9rmmsmmnelpaddchdlcudichindnilcubcufrincuupfkeypflocpfxmc0mc4mc5reprs1rs2rs3rfrcvpascindrisgrhtswindhttsluchuiprogka1ka3kb2kc1kc3mc5prmpacscplnkcbtsmxonrmxonsmamrmamxoncxoffcenacssmlnrmlnkbegkcankclokcmdkcpykcrtkendkentkextkfndkhlpkmrkkmsgkmovknxtkopnkoptkprvkprtkrdokrefkrfrkrplkrstkresksavkspdkundkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkRDOkRPLkRITkRESkSAVkSPDkUNDrfikf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63el1mgcsmglsmgrflnsclkdclkrmclkcwinwingohupdialqdialtonepulsehookpausewaitu0u1u2u3u4u5u6u7u8u9opocinitcinitpscpsetfsetbcpilpichrcvrdefcswidmsdrfqsitmslmsmicmsnlqsnrmqsshmssubmssupmsumrwidmritmrlmrmicmrshmrsubmrsupmrummhpamcud1mcub1mcuf1mvpamcuu1pordermcudmcubmcufmcuuscssmgbsmgbpsmglpsmgrpsmgtsmgtpsbimscsdrbimrcsdsubcssupcsdocrzeromcsnmdispcsmpchrmpchsmscrmscpctrmscescscesad @g @j @n @r @w @z @} @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @# @& @) @. @5 @; @? @E @K @Q @W @] @a @e @k @o @s @x @} @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @@ @@@@@#@(@,@1@6@:@@@E@K@P@U@Z@_@e@h@l@p@t@x@{@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@$@)@.@2@6@;@?@C@G@K@O@S@W@[@_@c@g@k@o@r@v@z@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@#@)@.@3@8@>@D@I@N@S@X@]@b@g@l@q@v@{@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@"@'@,@1@6@;@@@E@J@O@T@Y@^@c@h@l@q@v@{@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@ @%@*@/@4@9@>@C@H@M@R@W@\@a@f@k@p@u@y@}@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@#@)@/@4@8@>@C@I@N@T@Z@^@d@i@m@s@x@~@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@!@'@-@2@7@=@C@SVR3@5MS7) /etc/default/langLANG=l@english_us.asciiR9x@@english_us.ascii`<<@@english_us.ascii:D;@@english_us.ascii99@@english_us.ascii8:t:@@english_us.ascii::@english_us.asciiLC_CTYPEctypeLC_NUMERICnumericLC_TIMEtimeLC_COLLATEcollateLC_MESSAGESmessagesLC_MONETARYcurrencylibc: setlocale: : LANG environment variable syntax errorunable to open no line in syntax error in cannot open locale filecorrupt locale fileunknown error CLANG/usr/lib/lang//_./      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~yn-$ +29AKT[dhlptx|%m/%d/%y%H:%M:%SAMPM%a %b %d %X %Z %YSundayMondayTuesdayWednesdayThursdayFridaySaturdaySunMonTueWedThuFriSatJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberJanFebMarAprMayJunJulAugSepOctNovDecGG/bin/shsh-c  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ ((((( H @:'i _;?U3R)E?98p)D5} [%/ -I /wb5,6)6d>n G79 85q&5 1Z$.H+jt'!]6$J !5w%^_KLza N } dP@fff&h&QG!+ A j<h"2S58C7{-_k2+/4 U# >D K) m5\W?YU }?^Fz !%ph]( ZJ(9H/9Y!,0M@0M@-@8M@.,@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_sP...QkeyboardXmkdev[terminfoQ.P..Rfra.ibmSger.ibmTita.ibmUspa.ibmVukd.ibmWusa.ibmWat.ibm.usa# @(#) fra.ibm 23.1 91/08/29 # # Copyright (C) 1985-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # SCO Mapkey File # # Differences in keytop layout between various manufacturers # of keyboards may require that this file be modified. # # French keyboard - PC character ROM # alt # scan cntrl alt alt cntrl lock # code base shift cntrl shift alt shift cntrl shift state 0 nop nop nop nop nop nop nop nop O 1 esc esc esc esc esc esc esc esc O 2 '&' '1' nop nop '`' '`' nop nop O 3 130 '2' nul nul '@' '@' nul nul O 4 '"' '3' nop nop '#' '#' nop nop O 5 '\'' '4' nop nop '\'' '4' nop nop O 6 '(' '5' nop nop '(' '5' nop nop O 7 0xb2 '6' rs rs '^' '^' rs rs O 8 138 '7' esc esc '[' '[' esc esc O 9 '!' '8' nop nop '!' '8' nop nop O 10 135 '9' gs gs ']' ']' gs gs O 11 133 '0' nop nop '{' '{' nop nop O 12 ')' 248 nop nop '|' '|' nop nop O 13 '-' '_' ns ns '}' '}' ns ns O 14 bs bs del del bs bs del del O 15 ht btab nop nop ht btab nop nop O 16 'a' 'A' soh soh 'a' 'A' soh soh C 17 'z' 'Z' sub sub 'z' 'Z' sub sub C 18 'e' 'E' enq enq 'e' 'E' enq enq C 19 'r' 'R' dc2 dc2 'r' 'R' dc2 dc2 C 20 't' 'T' dc4 dc4 't' 'T' dc4 dc4 C 21 'y' 'Y' em em 'y' 'Y' em em C 22 'u' 'U' nak nak 'u' 'U' nak nak C 23 'i' 'I' ht ht 'i' 'I' ht ht C 24 'o' 'O' si si 'o' 'O' si si C 25 'p' 'P' dle dle 'p' 'P' dle dle C 26 0xb0 0xb1 esc esc '[' '{' esc esc O 27 '$' '*' gs gs ']' '}' gs gs O 28 cr cr nl nl cr cr nl nl O 29 lctrl lctrl lctrl lctrl lctrl lctrl lctrl lctrl O 30 'q' 'Q' dc1 dc1 'q' 'Q' dc1 dc1 C 31 's' 'S' dc3 dc3 's' 'S' dc3 dc3 C 32 'd' 'D' eot eot 'd' 'D' eot eot C 33 'f' 'F' ack ack 'f' 'F' ack ack C 34 'g' 'G' bel bel 'g' 'G' bel bel C 35 'h' 'H' bs bs 'h' 'H' bs bs C 36 'j' 'J' nl nl 'j' 'J' nl nl C 37 'k' 'K' vt vt 'k' 'K' vt vt C 38 'l' 'L' np np 'l' 'L' np np C 39 'm' 'M' cr cr 'm' 'M' cr cr C 40 151 '%' nop nop 151 '%' nop nop O 41 '<' '>' fs fs '\\' '|' fs fs O 42 lshift lshift lshift lshift lshift lshift lshift lshift O 43 230 156 nop nop '`' '~' nop nop O 44 'w' 'W' etb etb 'w' 'W' etb etb C 45 'x' 'X' can can 'x' 'X' can can C 46 'c' 'C' etx etx 'c' 'C' etx etx C 47 'v' 'V' syn syn 'v' 'V' syn syn C 48 'b' 'B' stx stx 'b' 'B' stx stx C 49 'n' 'N' so so 'n' 'N' so so C 50 ',' '?' nop nop ',' '?' nop nop O 51 ';' '.' nop nop ';' '.' nop nop O 52 ':' '/' nop nop ':' '/' nop nop O 53 '=' '+' nop nop '=' '+' nop nop O 54 rshift rshift rshift rshift rshift rshift rshift rshift O 55 '*' '*' nscr nscr '*' '*' nscr nscr O 56 lalt lalt lalt lalt lalt lalt lalt lalt O 57 ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' O 58 clock clock clock clock clock clock clock clock O 59 fkey1 fkey13 fkey25 fkey37 scr1 scr11 scr1 scr11 O 60 fkey2 fkey14 fkey26 fkey38 scr2 scr12 scr2 scr12 O 61 fkey3 fkey15 fkey27 fkey39 scr3 scr13 scr3 scr13 O 62 fkey4 fkey16 fkey28 fkey40 scr4 scr14 scr4 scr14 O 63 fkey5 fkey17 fkey29 fkey41 scr5 scr15 scr5 scr15 O 64 fkey6 fkey18 fkey30 fkey42 scr6 scr16 scr6 scr16 O 65 fkey7 fkey19 fkey31 fkey43 scr7 scr7 scr7 scr7 O 66 fkey8 fkey20 fkey32 fkey44 scr8 scr8 scr8 scr8 O 67 fkey9 fkey21 fkey33 fkey45 scr9 scr9 scr9 scr9 O 68 fkey10 fkey22 fkey34 fkey46 scr10 scr10 scr10 scr10 O 69 nlock nlock dc3 dc3 nlock nlock dc3 dc3 O 70 slock slock del del slock slock del del O 71 fkey49 '7' '7' '7' '7' '7' '7' '7' N 72 fkey50 '8' '8' '8' '8' '8' '8' '8' N 73 fkey51 '9' '9' '9' '9' '9' '9' '9' N 74 fkey52 '-' ns ns '-' '-' '-' '-' N 75 fkey53 '4' '4' '4' '4' '4' '4' '4' N 76 fkey54 '5' '5' '5' '5' '5' '5' '5' N 77 fkey55 '6' rs rs '6' '6' '6' '6' N 78 fkey56 '+' '+' '+' '+' '+' '+' '+' N 79 fkey57 '1' '1' '1' '1' '1' '1' '1' N 80 fkey58 '2' '2' '2' '2' '2' '2' '2' N 81 fkey59 '3' '3' '3' '3' '3' '3' '3' N 82 fkey60 '0' '0' '0' '0' '0' '0' '0' N 83 del '.' del del del del del del N 84 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f O 85 nop nop nop nop nop nop nop nop O 86 nop nop nop nop nop nop nop nop O 87 fkey11 fkey23 fkey35 fkey47 scr11 scr11 scr11 scr11 O 88 fkey12 fkey24 fkey36 fkey48 scr12 scr12 scr12 scr12 O 89 nop nop nop nop nop nop nop nop O 90 nop nop nop nop nop nop nop nop O 91 nop nop nop nop nop nop nop nop O 92 nop nop nop nop nop nop nop nop O 93 nop nop nop nop nop nop nop nop O 94 nop nop nop nop nop nop nop nop O 95 nop nop nop nop nop nop nop nop O 96 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 O 97 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 O 98 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 O 99 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 O 100 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 O 111 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 O 102 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 O 103 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 O 104 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 O 105 del del del del del del del del N 106 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 O 107 nop nop nop nop nop nop nop nop O 108 nop nop nop nop nop nop nop nop O 109 nop nop nop nop nop nop nop nop O 110 nop nop nop nop nop nop nop nop O 111 nop nop nop nop nop nop nop nop O 112 nop nop nop nop nop nop nop nop O 113 nop nop nop nop nop nop nop nop O 114 nop nop nop nop nop nop nop nop O 116 nop nop nop nop nop nop nop nop O 117 nop nop nop nop nop nop nop nop O 118 nop nop nop nop nop nop nop nop O 119 nop nop nop nop nop nop nop nop O 120 nop nop nop nop nop nop nop nop O 121 nop nop nop nop nop nop nop nop O 122 nop nop nop nop nop nop nop nop O 123 nop nop nop nop nop nop nop nop O 124 nop nop nop nop nop nop nop nop O 125 nop nop nop nop nop nop nop nop O 126 nop nop nop nop nop nop nop nop O 127 nop nop nop nop nop nop nop nop O 128 rctrl rctrl rctrl rctrl rctrl rctrl rctrl rctrl O 129 ralt ralt ralt ralt ralt ralt ralt ralt O 130 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 O 131 del del del del del del del del N 132 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 O 133 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 O 134 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 O 135 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 O 136 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 O 137 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 O 138 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 O 139 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 O 140 '/' nop nop nop '/' nop nop nop O 141 cr cr nl nl cr cr nl nl O # @(#) ger.ibm 23.1 91/08/29 # # Copyright (C) 1985-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # SCO Mapkey File # # Differences in keytop layout between various manufacturers # of keyboards may require that this file be modified. # # German keyboard - PC character ROM # alt # scan cntrl alt alt cntrl lock # code base shift cntrl shift alt shift cntrl shift state 0 nop nop nop nop nop nop nop nop O 1 esc esc esc esc esc esc esc esc O 2 '1' '!' nop nop '`' '`' nop nop O 3 '2' '"' nul nul '@' '@' nul nul O 4 '3' 178 nop nop '#' '#' nop nop O 5 '4' '$' nop nop '4' '$' nop nop O 6 '5' '%' nop nop '5' '%' nop nop O 7 '6' '&' rs rs '^' '^' rs rs O 8 '7' '/' esc esc '[' '[' esc esc O 9 '8' '(' nop nop '8' '(' nop nop O 10 '9' ')' gs gs ']' ']' gs gs O 11 '0' '=' nop nop '{' '{' nop nop O 12 225 '?' nop nop '|' '|' nop nop O 13 0xb3 0xb4 nop nop '\'' '`' nop nop O 14 bs bs del del bs bs del del O 15 ht btab nop nop ht btab nop nop O 16 'q' 'Q' dc1 dc1 'q' 'Q' dc1 dc1 C 17 'w' 'W' etb etb 'w' 'W' etb etb C 18 'e' 'E' enq enq 'e' 'E' enq enq C 19 'r' 'R' dc2 dc2 'r' 'R' dc2 dc2 C 20 't' 'T' dc4 dc4 't' 'T' dc4 dc4 C 21 'z' 'Z' sub sub 'z' 'Z' sub sub C 22 'u' 'U' nak nak 'u' 'U' nak nak C 23 'i' 'I' ht ht 'i' 'I' ht ht C 24 'o' 'O' si si 'o' 'O' si si C 25 'p' 'P' dle dle 'p' 'P' dle dle C 26 129 154 esc esc '[' '{' esc esc C 27 '+' '*' gs gs ']' '}' gs gs O 28 cr cr nl nl cr cr nl nl O 29 lctrl lctrl lctrl lctrl lctrl lctrl lctrl lctrl O 30 'a' 'A' soh soh 'a' 'A' soh soh C 31 's' 'S' dc3 dc3 's' 'S' dc3 dc3 C 32 'd' 'D' eot eot 'd' 'D' eot eot C 33 'f' 'F' ack ack 'f' 'F' ack ack C 34 'g' 'G' bel bel 'g' 'G' bel bel C 35 'h' 'H' bs bs 'h' 'H' bs bs C 36 'j' 'J' nl nl 'j' 'J' nl nl C 37 'k' 'K' vt vt 'k' 'K' vt vt C 38 'l' 'L' np np 'l' 'L' np np C 39 148 153 nop nop 148 153 nop nop C 40 132 142 nop nop 132 142 nop nop C 41 '<' '>' fs fs '\\' '|' fs fs O 42 lshift lshift lshift lshift lshift lshift lshift lshift O 43 '#' '^' rs rs '`' '~' rs rs O 44 'y' 'Y' em em 'y' 'Y' em em C 45 'x' 'X' can can 'x' 'X' can can C 46 'c' 'C' etx etx 'c' 'C' etx etx C 47 'v' 'V' syn syn 'v' 'V' syn syn C 48 'b' 'B' stx stx 'b' 'B' stx stx C 49 'n' 'N' so so 'n' 'N' so so C 50 'm' 'M' cr cr 'm' 'M' cr cr C 51 ',' ';' nop nop ',' ';' nop nop O 52 '.' ':' nop nop '.' ':' nop nop O 53 '-' '_' ns ns '-' '_' ns ns O 54 rshift rshift rshift rshift rshift rshift rshift rshift O 55 '*' '*' nscr nscr '*' '*' nscr nscr O 56 lalt lalt lalt lalt lalt lalt lalt lalt O 57 ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' O 58 clock clock clock clock clock clock clock clock O 59 fkey1 fkey13 fkey25 fkey37 scr1 scr11 scr1 scr11 O 60 fkey2 fkey14 fkey26 fkey38 scr2 scr12 scr2 scr12 O 61 fkey3 fkey15 fkey27 fkey39 scr3 scr13 scr3 scr13 O 62 fkey4 fkey16 fkey28 fkey40 scr4 scr14 scr4 scr14 O 63 fkey5 fkey17 fkey29 fkey41 scr5 scr15 scr5 scr15 O 64 fkey6 fkey18 fkey30 fkey42 scr6 scr16 scr6 scr16 O 65 fkey7 fkey19 fkey31 fkey43 scr7 scr7 scr7 scr7 O 66 fkey8 fkey20 fkey32 fkey44 scr8 scr8 scr8 scr8 O 67 fkey9 fkey21 fkey33 fkey45 scr9 scr9 scr9 scr9 O 68 fkey10 fkey22 fkey34 fkey46 scr10 scr10 scr10 scr10 O 69 nlock nlock dc3 dc3 nlock nlock dc3 dc3 O 70 slock slock del del slock slock del del O 71 fkey49 '7' '7' '7' '7' '7' '7' '7' N 72 fkey50 '8' '8' '8' '8' '8' '8' '8' N 73 fkey51 '9' '9' '9' '9' '9' '9' '9' N 74 fkey52 '-' '-' '-' '-' '-' '-' '-' N 75 fkey53 '4' '4' '4' '4' '4' '4' '4' N 76 fkey54 '5' '5' '5' '5' '5' '5' '5' N 77 fkey55 '6' '6' '6' '6' '6' '6' '6' N 78 fkey56 '+' '+' '+' '+' '+' '+' '+' N 79 fkey57 '1' '1' '1' '1' '1' '1' '1' N 80 fkey58 '2' '2' '2' '2' '2' '2' '2' N 81 fkey59 '3' '3' '3' '3' '3' '3' '3' N 82 fkey60 '0' '0' '0' '0' '0' '0' '0' N 83 del '.' del del del del del del N 84 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f O 85 nop nop nop nop nop nop nop nop O 86 nop nop nop nop nop nop nop nop O 87 fkey11 fkey23 fkey35 fkey47 scr11 scr11 scr11 scr11 O 88 fkey12 fkey24 fkey36 fkey48 scr12 scr12 scr12 scr12 O 89 nop nop nop nop nop nop nop nop O 90 nop nop nop nop nop nop nop nop O 91 nop nop nop nop nop nop nop nop O 92 nop nop nop nop nop nop nop nop O 93 nop nop nop nop nop nop nop nop O 94 nop nop nop nop nop nop nop nop O 95 nop nop nop nop nop nop nop nop O 96 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 O 97 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 O 98 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 O 99 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 O 100 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 O 111 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 O 102 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 O 103 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 O 104 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 O 105 del del del del del del del del N 106 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 O 107 nop nop nop nop nop nop nop nop O 108 nop nop nop nop nop nop nop nop O 109 nop nop nop nop nop nop nop nop O 110 nop nop nop nop nop nop nop nop O 111 nop nop nop nop nop nop nop nop O 112 nop nop nop nop nop nop nop nop O 113 nop nop nop nop nop nop nop nop O 114 nop nop nop nop nop nop nop nop O 116 nop nop nop nop nop nop nop nop O 117 nop nop nop nop nop nop nop nop O 118 nop nop nop nop nop nop nop nop O 119 nop nop nop nop nop nop nop nop O 120 nop nop nop nop nop nop nop nop O 121 nop nop nop nop nop nop nop nop O 122 nop nop nop nop nop nop nop nop O 123 nop nop nop nop nop nop nop nop O 124 nop nop nop nop nop nop nop nop O 125 nop nop nop nop nop nop nop nop O 126 nop nop nop nop nop nop nop nop O 127 nop nop nop nop nop nop nop nop O 128 rctrl rctrl rctrl rctrl rctrl rctrl rctrl rctrl O 129 ralt ralt ralt ralt ralt ralt ralt ralt O 130 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 O 131 del del del del del del del del N 132 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 O 133 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 O 134 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 O 135 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 O 136 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 O 137 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 O 138 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 O 139 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 O 140 '/' nop nop nop '/' nop nop nop O 141 cr cr nl nl cr cr nl nl O # @(#) ita.ibm 23.1 91/08/29 # # Copyright (C) 1985-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # SCO Mapkey File # # Differences in keytop layout between various manufacturers # of keyboards may require that this file be modified. # # Italian keyboard - PC character ROM # alt # scan cntrl alt alt cntrl lock # code base shift cntrl shift alt shift cntrl shift state 0 nop nop nop nop nop nop nop nop O 1 esc esc esc esc esc esc esc esc O 2 '1' '!' nop nop '`' '`' nop nop O 3 '2' '"' nul nul '@' '@' nul nul O 4 '3' 156 nop nop '#' '#' nop nop O 5 '4' '$' nop nop '4' '$' nop nop O 6 '5' '%' nop nop '5' '%' nop nop O 7 '6' '&' rs rs '^' '^' rs rs O 8 '7' '/' esc esc '[' '[' esc esc O 9 '8' '(' nop nop '8' '(' nop nop O 10 '9' ')' gs gs ']' ']' gs gs O 11 '0' '=' nop nop '{' '{' nop nop O 12 '\'' '?' nop nop '|' '|' nop nop O 13 141 '^' rs rs '}' '}' rs rs O 14 bs bs del del bs bs del del O 15 ht btab nop nop ht btab nop nop O 16 'q' 'Q' dc1 dc1 'q' 'Q' dc1 dc1 C 17 'w' 'W' etb etb 'w' 'W' etb etb C 18 'e' 'E' enq enq 'e' 'E' enq enq C 19 'r' 'R' dc2 dc2 'r' 'R' dc2 dc2 C 20 't' 'T' dc4 dc4 't' 'T' dc4 dc4 C 21 'y' 'Y' em em 'y' 'Y' em em C 22 'u' 'U' nak nak 'u' 'U' nak nak C 23 'i' 'I' ht ht 'i' 'I' ht ht C 24 'o' 'O' si si 'o' 'O' si si C 25 'p' 'P' dle dle 'p' 'P' dle dle C 26 138 130 esc esc '[' '{' esc esc O 27 '+' '*' gs gs ']' '}' gs gs O 28 cr cr nl nl cr cr nl nl O 29 lctrl lctrl lctrl lctrl lctrl lctrl lctrl lctrl O 30 'a' 'A' soh soh 'a' 'A' soh soh C 31 's' 'S' dc3 dc3 's' 'S' dc3 dc3 C 32 'd' 'D' eot eot 'd' 'D' eot eot C 33 'f' 'F' ack ack 'f' 'F' ack ack C 34 'g' 'G' bel bel 'g' 'G' bel bel C 35 'h' 'H' bs bs 'h' 'H' bs bs C 36 'j' 'J' nl nl 'j' 'J' nl nl C 37 'k' 'K' vt vt 'k' 'K' vt vt C 38 'l' 'L' np np 'l' 'L' np np C 39 149 '@' nul nul 149 '@' nul nul O 40 133 '#' nop nop 133 '#' nop nop O 41 '<' '>' fs fs '\\' '|' fs fs O 42 lshift lshift lshift lshift lshift lshift lshift lshift O 43 151 0xb2 nop nop '`' '~' nop nop O 44 'z' 'Z' sub sub 'z' 'Z' sub sub C 45 'x' 'X' can can 'x' 'X' can can C 46 'c' 'C' etx etx 'c' 'C' etx etx C 47 'v' 'V' syn syn 'v' 'V' syn syn C 48 'b' 'B' stx stx 'b' 'B' stx stx C 49 'n' 'N' so so 'n' 'N' so so C 50 'm' 'M' cr cr 'm' 'M' cr cr C 51 ',' ';' nop nop ',' ';' nop nop O 52 '.' ':' nop nop '.' ':' nop nop O 53 '-' '_' ns ns '-' '_' ns ns O 54 rshift rshift rshift rshift rshift rshift rshift rshift O 55 '*' '*' nscr nscr '*' '*' nscr nscr O 56 lalt lalt lalt lalt lalt lalt lalt lalt O 57 ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' O 58 clock clock clock clock clock clock clock clock O 59 fkey1 fkey13 fkey25 fkey37 scr1 scr11 scr1 scr11 O 60 fkey2 fkey14 fkey26 fkey38 scr2 scr12 scr2 scr12 O 61 fkey3 fkey15 fkey27 fkey39 scr3 scr13 scr3 scr13 O 62 fkey4 fkey16 fkey28 fkey40 scr4 scr14 scr4 scr14 O 63 fkey5 fkey17 fkey29 fkey41 scr5 scr15 scr5 scr15 O 64 fkey6 fkey18 fkey30 fkey42 scr6 scr16 scr6 scr16 O 65 fkey7 fkey19 fkey31 fkey43 scr7 scr7 scr7 scr7 O 66 fkey8 fkey20 fkey32 fkey44 scr8 scr8 scr8 scr8 O 67 fkey9 fkey21 fkey33 fkey45 scr9 scr9 scr9 scr9 O 68 fkey10 fkey22 fkey34 fkey46 scr10 scr10 scr10 scr10 O 69 nlock nlock dc3 dc3 nlock nlock dc3 dc3 O 70 slock slock del del slock slock del del O 71 fkey49 '7' '7' '7' '7' '7' '7' '7' N 72 fkey50 '8' '8' '8' '8' '8' '8' '8' N 73 fkey51 '9' '9' '9' '9' '9' '9' '9' N 74 fkey52 '-' '-' '-' '-' '-' '-' '-' N 75 fkey53 '4' '4' '4' '4' '4' '4' '4' N 76 fkey54 '5' '5' '5' '5' '5' '5' '5' N 77 fkey55 '6' '6' '6' '6' '6' '6' '6' N 78 fkey56 '+' '+' '+' '+' '+' '+' '+' N 79 fkey57 '1' '1' '1' '1' '1' '1' '1' N 80 fkey58 '2' '2' '2' '2' '2' '2' '2' N 81 fkey59 '3' '3' '3' '3' '3' '3' '3' N 82 fkey60 '0' '0' '0' '0' '0' '0' '0' N 83 del '.' del del del del del del N 84 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f O 85 nop nop nop nop nop nop nop nop O 86 nop nop nop nop nop nop nop nop O 87 fkey11 fkey23 fkey35 fkey47 scr11 scr11 scr11 scr11 O 88 fkey12 fkey24 fkey36 fkey48 scr12 scr12 scr12 scr12 O 89 nop nop nop nop nop nop nop nop O 90 nop nop nop nop nop nop nop nop O 91 nop nop nop nop nop nop nop nop O 92 nop nop nop nop nop nop nop nop O 93 nop nop nop nop nop nop nop nop O 94 nop nop nop nop nop nop nop nop O 95 nop nop nop nop nop nop nop nop O 96 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 O 97 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 O 98 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 O 99 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 O 100 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 O 111 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 O 102 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 O 103 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 O 104 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 O 105 del del del del del del del del N 106 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 O 107 nop nop nop nop nop nop nop nop O 108 nop nop nop nop nop nop nop nop O 109 nop nop nop nop nop nop nop nop O 110 nop nop nop nop nop nop nop nop O 111 nop nop nop nop nop nop nop nop O 112 nop nop nop nop nop nop nop nop O 113 nop nop nop nop nop nop nop nop O 114 nop nop nop nop nop nop nop nop O 116 nop nop nop nop nop nop nop nop O 117 nop nop nop nop nop nop nop nop O 118 nop nop nop nop nop nop nop nop O 119 nop nop nop nop nop nop nop nop O 120 nop nop nop nop nop nop nop nop O 121 nop nop nop nop nop nop nop nop O 122 nop nop nop nop nop nop nop nop O 123 nop nop nop nop nop nop nop nop O 124 nop nop nop nop nop nop nop nop O 125 nop nop nop nop nop nop nop nop O 126 nop nop nop nop nop nop nop nop O 127 nop nop nop nop nop nop nop nop O 128 rctrl rctrl rctrl rctrl rctrl rctrl rctrl rctrl O 129 ralt ralt ralt ralt ralt ralt ralt ralt O 130 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 O 131 del del del del del del del del N 132 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 O 133 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 O 134 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 O 135 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 O 136 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 O 137 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 O 138 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 O 139 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 O 140 '/' nop nop nop '/' nop nop nop O 141 cr cr nl nl cr cr nl nl O # @(#) spa.ibm 23.1 91/08/29 # # Copyright (C) 1985-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # SCO Mapkey File # # Differences in keytop layout between various manufacturers # of keyboards may require that this file be modified. # # Spanish keyboard - PC character ROM # alt # scan cntrl alt alt cntrl lock # code base shift cntrl shift alt shift cntrl shift state 0 nop nop nop nop nop nop nop nop O 1 esc esc esc esc esc esc esc esc O 2 '1' 173 nop nop '`' '`' nop nop O 3 '2' 168 nul nul '@' '@' nul nul O 4 '3' '#' nop nop '#' '#' nop nop O 5 '4' '$' nop nop '4' '$' nop nop O 6 '5' '%' nop nop '5' '%' nop nop O 7 '6' '/' rs rs '^' '^' rs rs O 8 '7' '&' esc esc '[' '[' esc esc O 9 '8' '*' nop nop '8' '*' nop nop O 10 '9' '(' gs gs ']' ']' gs gs O 11 '0' ')' nop nop '{' '{' nop nop O 12 '-' '_' ns ns '|' '|' ns ns O 13 '=' '+' nop nop '}' '}' nop nop O 14 bs bs del del bs bs del del O 15 ht btab nop nop ht btab nop nop O 16 'q' 'Q' dc1 dc1 'q' 'Q' dc1 dc1 C 17 'w' 'W' etb etb 'w' 'W' etb etb C 18 'e' 'E' enq enq 'e' 'E' enq enq C 19 'r' 'R' dc2 dc2 'r' 'R' dc2 dc2 C 20 't' 'T' dc4 dc4 't' 'T' dc4 dc4 C 21 'y' 'Y' em em 'y' 'Y' em em C 22 'u' 'U' nak nak 'u' 'U' nak nak C 23 'i' 'I' ht ht 'i' 'I' ht ht C 24 'o' 'O' si si 'o' 'O' si si C 25 'p' 'P' dle dle 'p' 'P' dle dle C 26 0xb3 0xb1 esc esc '[' '{' esc esc O 27 0xb4 0xb0 gs gs ']' '}' gs gs O 28 cr cr nl nl cr cr nl nl O 29 lctrl lctrl lctrl lctrl lctrl lctrl lctrl lctrl O 30 'a' 'A' soh soh 'a' 'A' soh soh C 31 's' 'S' dc3 dc3 's' 'S' dc3 dc3 C 32 'd' 'D' eot eot 'd' 'D' eot eot C 33 'f' 'F' ack ack 'f' 'F' ack ack C 34 'g' 'G' bel bel 'g' 'G' bel bel C 35 'h' 'H' bs bs 'h' 'H' bs bs C 36 'j' 'J' nl nl 'j' 'J' nl nl C 37 'k' 'K' vt vt 'k' 'K' vt vt C 38 'l' 'L' np np 'l' 'L' np np C 39 164 165 nop nop 164 165 nop nop C 40 ';' ':' nop nop ';' ':' nop nop O 41 '<' '>' fs fs '\\' '|' fs fs O 42 lshift lshift lshift lshift lshift lshift lshift lshift O 43 135 128 nop nop '`' '~' nop nop C 44 'z' 'Z' sub sub 'z' 'Z' sub sub C 45 'x' 'X' can can 'x' 'X' can can C 46 'c' 'C' etx etx 'c' 'C' etx etx C 47 'v' 'V' syn syn 'v' 'V' syn syn C 48 'b' 'B' stx stx 'b' 'B' stx stx C 49 'n' 'N' so so 'n' 'N' so so C 50 'm' 'M' cr cr 'm' 'M' cr cr C 51 ',' '?' nop nop ',' '?' nop nop O 52 '.' '!' nop nop '.' '!' nop nop O 53 '\'' '"' nop nop '\'' '"' nop nop O 54 rshift rshift rshift rshift rshift rshift rshift rshift O 55 '*' '*' nscr nscr '*' '*' nscr nscr O 56 lalt lalt lalt lalt lalt lalt lalt lalt O 57 ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' O 58 clock clock clock clock clock clock clock clock O 59 fkey1 fkey13 fkey25 fkey37 scr1 scr11 scr1 scr11 O 60 fkey2 fkey14 fkey26 fkey38 scr2 scr12 scr2 scr12 O 61 fkey3 fkey15 fkey27 fkey39 scr3 scr13 scr3 scr13 O 62 fkey4 fkey16 fkey28 fkey40 scr4 scr14 scr4 scr14 O 63 fkey5 fkey17 fkey29 fkey41 scr5 scr15 scr5 scr15 O 64 fkey6 fkey18 fkey30 fkey42 scr6 scr16 scr6 scr16 O 65 fkey7 fkey19 fkey31 fkey43 scr7 scr7 scr7 scr7 O 66 fkey8 fkey20 fkey32 fkey44 scr8 scr8 scr8 scr8 O 67 fkey9 fkey21 fkey33 fkey45 scr9 scr9 scr9 scr9 O 68 fkey10 fkey22 fkey34 fkey46 scr10 scr10 scr10 scr10 O 69 nlock nlock dc3 dc3 nlock nlock dc3 dc3 O 70 slock slock del del slock slock del del O 71 fkey49 '7' '7' '7' '7' '7' '7' '7' N 72 fkey50 '8' '8' '8' '8' '8' '8' '8' N 73 fkey51 '9' '9' '9' '9' '9' '9' '9' N 74 fkey52 '-' '-' '-' '-' '-' '-' '-' N 75 fkey53 '4' '4' '4' '4' '4' '4' '4' N 76 fkey54 '5' '5' '5' '5' '5' '5' '5' N 77 fkey55 '6' '6' '6' '6' '6' '6' '6' N 78 fkey56 '+' '+' '+' '+' '+' '+' '+' N 79 fkey57 '1' '1' '1' '1' '1' '1' '1' N 80 fkey58 '2' '2' '2' '2' '2' '2' '2' N 81 fkey59 '3' '3' '3' '3' '3' '3' '3' N 82 fkey60 '0' '0' '0' '0' '0' '0' '0' N 83 del '.' del del del del del del N 84 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f O 85 nop nop nop nop nop nop nop nop O 86 nop nop nop nop nop nop nop nop O 87 fkey11 fkey23 fkey35 fkey47 scr11 scr11 scr11 scr11 O 88 fkey12 fkey24 fkey36 fkey48 scr12 scr12 scr12 scr12 O 89 nop nop nop nop nop nop nop nop O 90 nop nop nop nop nop nop nop nop O 91 nop nop nop nop nop nop nop nop O 92 nop nop nop nop nop nop nop nop O 93 nop nop nop nop nop nop nop nop O 94 nop nop nop nop nop nop nop nop O 95 nop nop nop nop nop nop nop nop O 96 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 O 97 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 O 98 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 O 99 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 O 100 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 O 111 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 O 102 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 O 103 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 O 104 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 O 105 del del del del del del del del N 106 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 O 107 nop nop nop nop nop nop nop nop O 108 nop nop nop nop nop nop nop nop O 109 nop nop nop nop nop nop nop nop O 110 nop nop nop nop nop nop nop nop O 111 nop nop nop nop nop nop nop nop O 112 nop nop nop nop nop nop nop nop O 113 nop nop nop nop nop nop nop nop O 114 nop nop nop nop nop nop nop nop O 116 nop nop nop nop nop nop nop nop O 117 nop nop nop nop nop nop nop nop O 118 nop nop nop nop nop nop nop nop O 119 nop nop nop nop nop nop nop nop O 120 nop nop nop nop nop nop nop nop O 121 nop nop nop nop nop nop nop nop O 122 nop nop nop nop nop nop nop nop O 123 nop nop nop nop nop nop nop nop O 124 nop nop nop nop nop nop nop nop O 125 nop nop nop nop nop nop nop nop O 126 nop nop nop nop nop nop nop nop O 127 nop nop nop nop nop nop nop nop O 128 rctrl rctrl rctrl rctrl rctrl rctrl rctrl rctrl O 129 ralt ralt ralt ralt ralt ralt ralt ralt O 130 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 O 131 del del del del del del del del N 132 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 O 133 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 O 134 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 O 135 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 O 136 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 O 137 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 O 138 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 O 139 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 O 140 '/' nop nop nop '/' nop nop nop O 141 cr cr nl nl cr cr nl nl O # @(#) ukd.ibm 23.1 91/08/29 # # Copyright (C) 1985-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # SCO Mapkey File # # Differences in keytop layout between various manufacturers # of keyboards may require that this file be modified. # # UK keyboard - PC character ROM # alt # scan cntrl alt alt cntrl lock # code base shift cntrl shift alt shift cntrl shift state 0 nop nop nop nop nop nop nop nop O 1 esc esc esc esc esc esc esc esc O 2 '1' '!' nop nop '`' '`' nop nop O 3 '2' '"' nul nul '@' '@' nul nul O 4 '3' 0x9c nop nop '#' '#' nop nop O 5 '4' '$' nop nop '4' '$' nop nop O 6 '5' '%' nop nop '5' '%' nop nop O 7 '6' '^' rs rs '^' '^' rs rs O 8 '7' '&' nop nop '[' '[' esc esc O 9 '8' '*' nop nop '8' '*' nop nop O 10 '9' '(' nop nop ']' ']' gs gs O 11 '0' ')' nop nop '{' '{' nop nop O 12 '-' '_' ns ns '|' '|' ns ns O 13 '=' '+' nop nop '}' '}' nop nop O 14 bs bs del del bs bs del del O 15 ht btab nop nop ht btab nop nop O 16 'q' 'Q' dc1 dc1 'q' 'Q' dc1 dc1 C 17 'w' 'W' etb etb 'w' 'W' etb etb C 18 'e' 'E' enq enq 'e' 'E' enq enq C 19 'r' 'R' dc2 dc2 'r' 'R' dc2 dc2 C 20 't' 'T' dc4 dc4 't' 'T' dc4 dc4 C 21 'y' 'Y' em em 'y' 'Y' em em C 22 'u' 'U' nak nak 'u' 'U' nak nak C 23 'i' 'I' ht ht 'i' 'I' ht ht C 24 'o' 'O' si si 'o' 'O' si si C 25 'p' 'P' dle dle 'p' 'P' dle dle C 26 '[' '{' esc esc '[' '{' esc esc O 27 ']' '}' gs gs ']' '}' gs gs O 28 cr cr nl nl cr cr nl nl O 29 lctrl lctrl lctrl lctrl lctrl lctrl lctrl lctrl O 30 'a' 'A' soh soh 'a' 'A' soh soh C 31 's' 'S' dc3 dc3 's' 'S' dc3 dc3 C 32 'd' 'D' eot eot 'd' 'D' eot eot C 33 'f' 'F' ack ack 'f' 'F' ack ack C 34 'g' 'G' bel bel 'g' 'G' bel bel C 35 'h' 'H' bs bs 'h' 'H' bs bs C 36 'j' 'J' nl nl 'j' 'J' nl nl C 37 'k' 'K' vt vt 'k' 'K' vt vt C 38 'l' 'L' np np 'l' 'L' np np C 39 ';' ':' nop nop ';' ':' nop nop O 40 '\'' '@' nul nul '\'' '@' nul nul O 41 '\\' '|' fs fs '`' '`' fs fs O 42 lshift lshift lshift lshift lshift lshift lshift lshift O 43 '#' '~' nop nop '`' '`' nop nop O 44 'z' 'Z' sub sub 'z' 'Z' sub sub C 45 'x' 'X' can can 'x' 'X' can can C 46 'c' 'C' etx etx 'c' 'C' etx etx C 47 'v' 'V' syn syn 'v' 'V' syn syn C 48 'b' 'B' stx stx 'b' 'B' stx stx C 49 'n' 'N' so so 'n' 'N' so so C 50 'm' 'M' cr cr 'm' 'M' cr cr C 51 ',' '<' nop nop ',' '<' nop nop O 52 '.' '>' nop nop '.' '>' nop nop O 53 '/' '?' nop nop '/' '?' nop nop O 54 rshift rshift rshift rshift rshift rshift rshift rshift O 55 '*' '*' nscr nscr '*' '*' nscr nscr O 56 lalt lalt lalt lalt lalt lalt lalt lalt O 57 ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' O 58 clock clock clock clock clock clock clock clock O 59 fkey1 fkey13 fkey25 fkey37 scr1 scr11 scr1 scr11 O 60 fkey2 fkey14 fkey26 fkey38 scr2 scr12 scr2 scr12 O 61 fkey3 fkey15 fkey27 fkey39 scr3 scr13 scr3 scr13 O 62 fkey4 fkey16 fkey28 fkey40 scr4 scr14 scr4 scr14 O 63 fkey5 fkey17 fkey29 fkey41 scr5 scr15 scr5 scr15 O 64 fkey6 fkey18 fkey30 fkey42 scr6 scr16 scr6 scr16 O 65 fkey7 fkey19 fkey31 fkey43 scr7 scr7 scr7 scr7 O 66 fkey8 fkey20 fkey32 fkey44 scr8 scr8 scr8 scr8 O 67 fkey9 fkey21 fkey33 fkey45 scr9 scr9 scr9 scr9 O 68 fkey10 fkey22 fkey34 fkey46 scr10 scr10 scr10 scr10 O 69 nlock nlock dc3 dc3 nlock nlock dc3 dc3 O 70 slock slock del del slock slock del del O 71 fkey49 '7' '7' '7' '7' '7' '7' '7' N 72 fkey50 '8' '8' '8' '8' '8' '8' '8' N 73 fkey51 '9' '9' '9' '9' '9' '9' '9' N 74 fkey52 '-' '-' '-' '-' '-' '-' '-' N 75 fkey53 '4' '4' '4' '4' '4' '4' '4' N 76 fkey54 '5' '5' '5' '5' '5' '5' '5' N 77 fkey55 '6' '6' '6' '6' '6' '6' '6' N 78 fkey56 '+' '+' '+' '+' '+' '+' '+' N 79 fkey57 '1' '1' '1' '1' '1' '1' '1' N 80 fkey58 '2' '2' '2' '2' '2' '2' '2' N 81 fkey59 '3' '3' '3' '3' '3' '3' '3' N 82 fkey60 '0' '0' '0' '0' '0' '0' '0' N 83 del '.' del del del del del del N 84 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f O 85 nop nop nop nop nop nop nop nop O 86 '\\' '|' fs fs '`' '`' fs fs O 87 fkey11 fkey23 fkey35 fkey47 scr11 scr11 scr11 scr11 O 88 fkey12 fkey24 fkey36 fkey48 scr12 scr12 scr12 scr12 O 89 nop nop nop nop nop nop nop nop O 90 nop nop nop nop nop nop nop nop O 91 nop nop nop nop nop nop nop nop O 92 nop nop nop nop nop nop nop nop O 93 nop nop nop nop nop nop nop nop O 94 nop nop nop nop nop nop nop nop O 95 nop nop nop nop nop nop nop nop O 96 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 O 97 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 O 98 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 O 99 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 O 100 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 O 111 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 O 102 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 O 103 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 O 104 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 O 105 del del del del del del del del N 106 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 O 107 nop nop nop nop nop nop nop nop O 108 nop nop nop nop nop nop nop nop O 109 nop nop nop nop nop nop nop nop O 110 nop nop nop nop nop nop nop nop O 111 nop nop nop nop nop nop nop nop O 112 nop nop nop nop nop nop nop nop O 113 nop nop nop nop nop nop nop nop O 114 nop nop nop nop nop nop nop nop O 116 nop nop nop nop nop nop nop nop O 117 nop nop nop nop nop nop nop nop O 118 nop nop nop nop nop nop nop nop O 119 nop nop nop nop nop nop nop nop O 120 nop nop nop nop nop nop nop nop O 121 nop nop nop nop nop nop nop nop O 122 nop nop nop nop nop nop nop nop O 123 nop nop nop nop nop nop nop nop O 124 nop nop nop nop nop nop nop nop O 125 nop nop nop nop nop nop nop nop O 126 nop nop nop nop nop nop nop nop O 127 nop nop nop nop nop nop nop nop O 128 rctrl rctrl rctrl rctrl rctrl rctrl rctrl rctrl O 129 ralt ralt ralt ralt ralt ralt ralt ralt O 130 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 O 131 del del del del del del del del N 132 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 O 133 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 O 134 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 O 135 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 O 136 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 O 137 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 O 138 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 O 139 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 O 140 '/' nop nop nop '/' nop nop nop O 141 cr cr nl nl cr cr nl nl O # @(#) usa.ibm 23.1 91/08/29 # # Copyright (C) 1985-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # SCO Mapkey File # # Differences in keytop layout between various manufacturers # of keyboards may require that this file be modified. # # US keyboard - PC character ROM # alt # scan cntrl alt alt cntrl lock # code base shift cntrl shift alt shift cntrl shift state 0 nop nop nop nop nop nop nop nop O 1 esc esc esc esc esc esc esc esc O 2 '1' '!' nop nop '1' '!' nop nop O 3 '2' '@' nul nul '2' '@' nul nul O 4 '3' '#' nop nop '3' '#' nop nop O 5 '4' '$' nop nop '4' '$' nop nop O 6 '5' '%' nop nop '5' '%' nop nop O 7 '6' '^' rs rs '6' '^' rs rs O 8 '7' '&' nop nop '7' '&' nop nop O 9 '8' '*' nop nop '8' '*' nop nop O 10 '9' '(' nop nop '9' '(' nop nop O 11 '0' ')' nop nop '0' ')' nop nop O 12 '-' '_' ns ns '-' '_' ns ns O 13 '=' '+' nop nop '=' '+' nop nop O 14 bs bs del del bs bs del del O 15 ht btab nop nop ht btab nop nop O 16 'q' 'Q' dc1 dc1 'q' 'Q' dc1 dc1 C 17 'w' 'W' etb etb 'w' 'W' etb etb C 18 'e' 'E' enq enq 'e' 'E' enq enq C 19 'r' 'R' dc2 dc2 'r' 'R' dc2 dc2 C 20 't' 'T' dc4 dc4 't' 'T' dc4 dc4 C 21 'y' 'Y' em em 'y' 'Y' em em C 22 'u' 'U' nak nak 'u' 'U' nak nak C 23 'i' 'I' ht ht 'i' 'I' ht ht C 24 'o' 'O' si si 'o' 'O' si si C 25 'p' 'P' dle dle 'p' 'P' dle dle C 26 '[' '{' esc esc '[' '{' esc esc O 27 ']' '}' gs gs ']' '}' gs gs O 28 cr cr nl nl cr cr nl nl O 29 lctrl lctrl lctrl lctrl lctrl lctrl lctrl lctrl O 30 'a' 'A' soh soh 'a' 'A' soh soh C 31 's' 'S' dc3 dc3 's' 'S' dc3 dc3 C 32 'd' 'D' eot eot 'd' 'D' eot eot C 33 'f' 'F' ack ack 'f' 'F' ack ack C 34 'g' 'G' bel bel 'g' 'G' bel bel C 35 'h' 'H' bs bs 'h' 'H' bs bs C 36 'j' 'J' nl nl 'j' 'J' nl nl C 37 'k' 'K' vt vt 'k' 'K' vt vt C 38 'l' 'L' np np 'l' 'L' np np C 39 ';' ':' nop nop ';' ':' nop nop O 40 '\'' '"' nop nop '\'' '"' nop nop O 41 '`' '~' nop nop '`' '~' nop nop O 42 lshift lshift lshift lshift lshift lshift lshift lshift O 43 '\\' '|' fs fs '\\' '|' fs fs O 44 'z' 'Z' sub sub 'z' 'Z' sub sub C 45 'x' 'X' can can 'x' 'X' can can C 46 'c' 'C' etx etx 'c' 'C' etx etx C 47 'v' 'V' syn syn 'v' 'V' syn syn C 48 'b' 'B' stx stx 'b' 'B' stx stx C 49 'n' 'N' so so 'n' 'N' so so C 50 'm' 'M' cr cr 'm' 'M' cr cr C 51 ',' '<' nop nop ',' '<' nop nop O 52 '.' '>' nop nop '.' '>' nop nop O 53 '/' '?' nop nop '/' '?' nop nop O 54 rshift rshift rshift rshift rshift rshift rshift rshift O 55 '*' '*' nscr nscr '*' '*' nscr nscr O 56 lalt lalt lalt lalt lalt lalt lalt lalt O 57 ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' O 58 clock clock clock clock clock clock clock clock O 59 fkey1 fkey13 fkey25 fkey37 scr1 scr11 scr1 scr11 O 60 fkey2 fkey14 fkey26 fkey38 scr2 scr12 scr2 scr12 O 61 fkey3 fkey15 fkey27 fkey39 scr3 scr13 scr3 scr13 O 62 fkey4 fkey16 fkey28 fkey40 scr4 scr14 scr4 scr14 O 63 fkey5 fkey17 fkey29 fkey41 scr5 scr15 scr5 scr15 O 64 fkey6 fkey18 fkey30 fkey42 scr6 scr16 scr6 scr16 O 65 fkey7 fkey19 fkey31 fkey43 scr7 scr7 scr7 scr7 O 66 fkey8 fkey20 fkey32 fkey44 scr8 scr8 scr8 scr8 O 67 fkey9 fkey21 fkey33 fkey45 scr9 scr9 scr9 scr9 O 68 fkey10 fkey22 fkey34 fkey46 scr10 scr10 scr10 scr10 O 69 nlock nlock dc3 dc3 nlock nlock dc3 dc3 O 70 slock slock del del slock slock del del O 71 fkey49 '7' '7' '7' '7' '7' '7' '7' N 72 fkey50 '8' '8' '8' '8' '8' '8' '8' N 73 fkey51 '9' '9' '9' '9' '9' '9' '9' N 74 fkey52 '-' '-' '-' '-' '-' '-' '-' N 75 fkey53 '4' '4' '4' '4' '4' '4' '4' N 76 fkey54 '5' '5' '5' '5' '5' '5' '5' N 77 fkey55 '6' '6' '6' '6' '6' '6' '6' N 78 fkey56 '+' '+' '+' '+' '+' '+' '+' N 79 fkey57 '1' '1' '1' '1' '1' '1' '1' N 80 fkey58 '2' '2' '2' '2' '2' '2' '2' N 81 fkey59 '3' '3' '3' '3' '3' '3' '3' N 82 fkey60 '0' '0' '0' '0' '0' '0' '0' N 83 del '.' del del del del del del N 84 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f 0x1f O 85 nop nop nop nop nop nop nop nop O 86 nop nop nop nop nop nop nop nop O 87 fkey11 fkey23 fkey35 fkey47 scr11 scr11 scr11 scr11 O 88 fkey12 fkey24 fkey36 fkey48 scr12 scr12 scr12 scr12 O 89 nop nop nop nop nop nop nop nop O 90 nop nop nop nop nop nop nop nop O 91 nop nop nop nop nop nop nop nop O 92 nop nop nop nop nop nop nop nop O 93 nop nop nop nop nop nop nop nop O 94 nop nop nop nop nop nop nop nop O 95 nop nop nop nop nop nop nop nop O 96 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 O 97 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 O 98 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 O 99 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 O 100 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 O 111 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 O 102 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 O 103 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 O 104 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 O 105 del del del del del del del del N 106 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 fkey54 O 107 nop nop nop nop nop nop nop nop O 108 nop nop nop nop nop nop nop nop O 109 nop nop nop nop nop nop nop nop O 110 nop nop nop nop nop nop nop nop O 111 nop nop nop nop nop nop nop nop O 112 nop nop nop nop nop nop nop nop O 113 nop nop nop nop nop nop nop nop O 114 nop nop nop nop nop nop nop nop O 116 nop nop nop nop nop nop nop nop O 117 nop nop nop nop nop nop nop nop O 118 nop nop nop nop nop nop nop nop O 119 nop nop nop nop nop nop nop nop O 120 nop nop nop nop nop nop nop nop O 121 nop nop nop nop nop nop nop nop O 122 nop nop nop nop nop nop nop nop O 123 nop nop nop nop nop nop nop nop O 124 nop nop nop nop nop nop nop nop O 125 nop nop nop nop nop nop nop nop O 126 nop nop nop nop nop nop nop nop O 127 nop nop nop nop nop nop nop nop O 128 rctrl rctrl rctrl rctrl rctrl rctrl rctrl rctrl O 129 ralt ralt ralt ralt ralt ralt ralt ralt O 130 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 fkey60 O 131 del del del del del del del del N 132 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 fkey49 O 133 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 fkey57 O 134 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 fkey51 O 135 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 fkey59 O 136 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 fkey55 O 137 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 fkey53 O 138 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 fkey50 O 139 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 fkey58 O 140 '/' nop nop nop '/' nop nop nop O 141 cr cr nl nl cr cr nl nl O X.P..Y.hdfuncsZhd: # @(#) hdfuncs.sh 23.13 91/12/31 # # Copyright (C) 1990-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # mkdev/.hdfuncs - Hard Disk Configuration functions # # Common functions for mkdev hd and other disk install/prep scripts # file should be sourced by front-end script # warning: several environmental dependencies in both directions #Link-kit access: needed for node.d and mscsi files #Now support a new minor device numbering scheme for Dos partitions #Added support of Dos logical drives in the extended Dos partition link_root=/etc/conf link_bin=$link_root/bin mdev=$link_root/cf.d/mdevice node_root=$link_root/node.d mscsi=$link_root/cf.d/mscsi hdlist=/usr/lib/mkdev/perms/HDLIST dkconf=/usr/lib/mkdev/perms/DKINIT # define some numbers and flags here interactive=yes # interactive or not diskpercent=120 # nice round number used to calculate max badtrks (8%) rootinstall= # flag to say whether we're installing root disk relink=0 tmp=/tmp/hd_ no_args= # Standard functions # Prompt with mesg, return non-zero on q prompt() { while echo "\n${mesg}or enter q to quit: \c" >&2 do read cmd case $cmd in +x|-x) set $cmd ;; Q|q) return $FAIL ;; !*) eval `expr "$cmd" : "!\(.*\)"` ;; "") # If there is an argument use it as the default # else loop until 'cmd' is set [ "$1" ] && { cmd=$1 return $OK } : continue ;; *) return $OK ;; esac done } # Prompt for yes or no answer - returns non-zero for no getyn() { while echo "\n$* (y/n) \c">&2 do read yn rest case $yn in [yY]) return $OK ;; [nN]) return $FAIL ;; *) echo "Please answer y or n" >&2 ;; esac done } # set that the link-kit is installed check_link () { dir=`pwd` cd / if [ -f /etc/perms/extmd ] then PERM=/etc/perms/extmd else echo "Cannot locate /etc/perms/extmd. This file\nis needed to verify Link Kit installation." 1>&2 # or return 1 cleanup $FAIL fi # test to see if link kit is installed until fixperm -i -d LINK $PERM do case $? in 0) echo "fixperm returned 0 in Link Kit check" return 0 ;; 4) echo "\nThe Link Kit is not installed." >&2 ;; 5) echo "\nThe Link Kit is only partially installed." >&2 ;; *) echo "\nError testing for Link Kit. Exiting.">&2 cleanup $FAIL ;; esac # Not fully installed. Do so here getyn "Do you wish to install it now?" || { # answered no echo " Disk devices cannot be installed without the Link Kit. Re-invoke this mkdev script after installing the Link Kit.">&2 cleanup $FAIL } # answered yes, so install link kit /bin/sh -c /etc/custom -o -i LINK || { # custom exited unsuccessfully error "custom failed to install Link Kit successfully. Please try again." cleanup $FAIL } done cd $dir return 0 } # functions specific to generic hard disk installations # set next available disknum from hdlist set_disknum() { disknum=1 [ -f $hdlist ] && { #check to see if device files already exist for this #device; if so, use the old disk number set_node_d LAST=`grep -v "^#" $hdlist | grep " $node_d $minor_seed\$" ` LAST=`expr "$LAST" : '\([0-9][0-9]*\)'` if [ "$LAST" ] then disknum=$LAST echo "\nDisk already configured as disk number $disknum (/dev/dsk/${disknum}s0)" olddisk=1 else LAST=`grep -v "^#" $hdlist | sort -n | tail -1` LAST=`expr "$LAST" : '\([0-9][0-9]*\)'` [ "$LAST" ] && disknum=`expr $LAST + 1` fi } cdev=/dev/rdsk/${disknum}s0 } #Determine appropriate node.d file for building device nodes with idmknod set_node_d () { major_to_driver node_d=$node_root/$driver } #Add device node definitions to node.d file; create new set of device #files using idmknod #update $HDLIST fix () { #determine driver node.d file set_node_d # backup old node.d and hdlist file [ -f $node_d ] && cp $node_d ${node_d}.00 [ -f $hdlist ] && cp $hdlist ${hdlist}.00 [ -f $dkconf ] && cp $dkconf ${dkconf}.00 echotext=" $driver dsk/${disknum}s0 b ${minor_0} sysinfo sysinfo 600 $driver dsk/${disknum}s1 b ${minor_1} sysinfo sysinfo 600 $driver dsk/${disknum}s2 b ${minor_2} sysinfo sysinfo 600 $driver dsk/${disknum}s3 b ${minor_3} sysinfo sysinfo 600 $driver dsk/${disknum}s4 b ${minor_4} sysinfo sysinfo 600 $driver dsk/${disknum}sa b ${minor_a} sysinfo sysinfo 600 $driver dsk/${disknum}sd b ${minor_d} dos sysinfo 640 $driver dsk/${disknum}sC b ${minor_C} dos sysinfo 640 $driver dsk/${disknum}sD b ${minor_D} dos sysinfo 640 $driver dsk/${disknum}sE b ${minor_E} dos sysinfo 640 $driver dsk/${disknum}sF b ${minor_F} dos sysinfo 640 $driver dsk/${disknum}sG b ${minor_G} dos sysinfo 640 $driver dsk/${disknum}sH b ${minor_H} dos sysinfo 640 $driver dsk/${disknum}sI b ${minor_I} dos sysinfo 640 $driver dsk/${disknum}sJ b ${minor_J} dos sysinfo 640 $driver rdsk/${disknum}s0 c ${minor_0} sysinfo sysinfo 600 $driver rdsk/${disknum}s1 c ${minor_1} sysinfo sysinfo 600 $driver rdsk/${disknum}s2 c ${minor_2} sysinfo sysinfo 600 $driver rdsk/${disknum}s3 c ${minor_3} sysinfo sysinfo 600 $driver rdsk/${disknum}s4 c ${minor_4} sysinfo sysinfo 600 $driver rdsk/${disknum}sa c ${minor_a} sysinfo sysinfo 600 $driver rdsk/${disknum}sd c ${minor_d} dos sysinfo 640 $driver rdsk/${disknum}sC c ${minor_C} dos sysinfo 640 $driver rdsk/${disknum}sD c ${minor_D} dos sysinfo 640 $driver rdsk/${disknum}sE c ${minor_E} dos sysinfo 640 $driver rdsk/${disknum}sF c ${minor_F} dos sysinfo 640 $driver rdsk/${disknum}sG c ${minor_G} dos sysinfo 640 $driver rdsk/${disknum}sH c ${minor_H} dos sysinfo 640 $driver rdsk/${disknum}sI c ${minor_I} dos sysinfo 640 $driver rdsk/${disknum}sJ c ${minor_J} dos sysinfo 640 " if [ "$disknum" = "1" -o "$disknum" = "2" -o "$disknum" = "3" ] then echotext="$echotext $driver hd${disknum}0 b ${minor_0} sysinfo sysinfo 600 $driver hd${disknum}1 b ${minor_1} sysinfo sysinfo 600 $driver hd${disknum}2 b ${minor_2} sysinfo sysinfo 600 $driver hd${disknum}3 b ${minor_3} sysinfo sysinfo 600 $driver hd${disknum}4 b ${minor_4} sysinfo sysinfo 600 $driver hd${disknum}a b ${minor_a} sysinfo sysinfo 600 $driver hd${disknum}d b ${minor_d} dos sysinfo 640 $driver rhd${disknum}0 c ${minor_0} sysinfo sysinfo 600 $driver rhd${disknum}1 c ${minor_1} sysinfo sysinfo 600 $driver rhd${disknum}2 c ${minor_2} sysinfo sysinfo 600 $driver rhd${disknum}3 c ${minor_3} sysinfo sysinfo 600 $driver rhd${disknum}4 c ${minor_4} sysinfo sysinfo 600 $driver rhd${disknum}a c ${minor_a} sysinfo sysinfo 600 $driver rhd${disknum}d c ${minor_d} dos sysinfo 640 " fi echo "$echotext" >> $node_d sort -u $node_d > ${tmp}4.$$ mv ${tmp}4.$$ $node_d grep "$disknum $node_d $minor_seed" $hdlist > /dev/null 2>&1 [ $? -ne 0 ] && echo "$disknum $node_d $minor_seed" >> $hdlist fixdone=TRUE #make nodes now using idmknod and tmp node.d directory tmpnodes=/tmp/hdnodes$$ if [ -d $tmpnodes ] then rm -rf $tmpnodes/* else mkdir $tmpnodes fi echo "$echotext" > $tmpnodes/$driver #cleanup any old/conflicting ones (idmknod will die if conflicts) unsettrap rm -f /dev/dsk/${disknum}s* 2> /dev/null rm -f /dev/rdsk/${disknum}s* 2> /dev/null rm -f /dev/hd${disknum}? 2> /dev/null rm -f /dev/rhd${disknum}? 2> /dev/null #make the new ones $link_bin/idmknod -s -e $tmpnodes || { rm -rf $tmpnodes error mknod_fail } settrap nodedone=TRUE rm -rf $tmpnodes } # determine the root hard disk type get_root_type () { rootdisk= cdev= # root: need to tickle the disk so that driver prints config info [ -n "$rootinstall" ] && dparam /dev/rdsk/0s0 > /dev/null 2>&1 type=`sed -n "/%disk/s/.*\(type=.\).*/\1/p" < /dev/string/cfg` case $type in type=S*) rootdisk=S ;; type=E*) rootdisk=E ;; type=W*) rootdisk=W ;; type=I*) rootdisk=I ;; *) error root_fail ;; esac [ -n "$rootinstall" ] && newtype=$rootdisk return $OK } # set minor numbers for use by fix () # if scsi, set 'physical' argument for divvy set_minors () { if [ "$newtype" = "S" ] then # SCSI installation # scsi_index set in scsi_config() physical=$scsi_index else physical=$drivenum fi minor_seed=`expr $physical \* 64` minor_0=$minor_seed minor_1=`expr $minor_seed + 15` minor_2=`expr $minor_seed + 23` minor_3=`expr $minor_seed + 31` minor_4=`expr $minor_seed + 39` minor_a=`expr $minor_seed + 47` minor_C=`expr $minor_seed + 48` minor_D=`expr $minor_seed + 49` minor_E=`expr $minor_seed + 50` minor_F=`expr $minor_seed + 51` minor_G=`expr $minor_seed + 52` minor_H=`expr $minor_seed + 53` minor_I=`expr $minor_seed + 54` minor_J=`expr $minor_seed + 55` minor_d=$minor_C set_exminors $minor_seed } set_exminors() { off=$1 [ "$off" -gt 255 ] && { off=`expr \( $off - \( $off % 256 \) \)` olddir=`pwd` cd $link_root/cf.d ./configure -m $major -t -X $off && { ./configure -m $major -b -c -a -X $off relink=`expr $relink + 1 ` } cd $olddir } } # called with $OK (0) if successful; $FAIL (1) or other args on failure cleanup () { [ "$rootinstall" = "TRUE" ] && { if [ "$1" != "0" ] then case $1 in fdisk_err) echo "/etc/fdisk failed." ;; batch_fdisk) echo "Cannot create a single, active UNIX virtual drive." ;; esac exit $FAIL fi exit $OK } # clean up perms file and remove unused disk devices rm -f ${tmp}?.$$ 2> /dev/null if [ "$1" != "0" ] then # new disk wasn't successfully accessed unsettrap [ "$fixdone" = "TRUE" ] && { # Restore previous node.d and hdlist files [ -f ${hdlist}.00 ] && mv ${hdlist}.00 $hdlist [ -f ${node_d}.00 ] && mv ${node_d}.00 $node_d [ -f ${dkconf}.00 ] && mv ${dkconf}.00 $dkconf } # remove newly created devices [ "$nodedone" = "TRUE" -a "$olddisk" -ne 1 ] && { rm -f /dev/dsk/${disknum}s* 2> /dev/null rm -f /dev/rdsk/${disknum}s* 2> /dev/null  rm -f /dev/hd${disknum}? 2> /dev/null rm -f /dev/rhd${disknum}? 2> /dev/null } settrap [ "$1" = "fdisk_err" ] && echo "/etc/fdisk failed." exit $FAIL fi # non-root install successful # clean-up backup versions of node.d and hdlist files rm -f ${hdlist}.00 rm -f ${node_d}.00 rm -f ${dkconf}.00 exit $OK } # Does the fdisk and, if necessary, does the badtrk as well diskprep () { # set the character device of the disk we are interested in cdev=${cdev:-/dev/rdsk/0s0} # if a SCSI disk, only run fdisk [ "$newtype" = "S" -o "$newtype" = "I" ] && { if [ -n "$interactive" ] then # do the interactive fdisk utilmsg "/etc/fdisk" /etc/fdisk -f $cdev || cleanup fdisk_err getactive=`fdisk -p -f $cdev` while [ 0 -eq `expr "$getactive" : '.*UNIX[ ]*Active.*'` ] && getyn "Do you wish to specify an active UNIX partition?" do /etc/fdisk -f $cdev || cleanup fdisk_err getactive=`fdisk -p -f $cdev` done else # do the non interactive fdisk batchfdisk || cleanup batch_fdisk fi return $OK } # $disknum is set in check_args() actdev=/dev/rdsk/${disknum:-0}sa # if on an OMTI controller, run fdisk and create space for badtrks [ "${newtype}$arch" = "EAT" ] && { if [ -n "$interactive" ] then # do the interactive fdisk utilmsg "/etc/fdisk" /etc/fdisk -f $cdev || cleanup fdisk_err getactive=`fdisk -p -f $cdev` while [ 0 -eq `expr "$getactive" : '.*UNIX[ ]*Active.*'` ] && getyn "Do you wish to specify an active UNIX partition?" do /etc/fdisk -f $cdev || cleanup fdisk_err getactive=`fdisk -p -f $cdev` done else # do the non interactive fdisk batchfdisk || cleanup batch_fdisk fi batchbadtrk # no args = don't do it, just make space return $OK } # Badtrack ST506 and ESDI disks. # give this message on interactive use only [ -n "$interactive" ] && { echo " The hard disk installation program will now invoke two disk preparation utilities: fdisk and badtrk. Selecting 'q' at the main menu for each utility will exit that utility and continue with the hard disk installation. To exit the entire installation at these menus, press the key." } # Partition the disk and badtrk the active virtual drive if [ -n "$interactive" ] then # Loop until the user has partitioned around bad tracks until /etc/fdisk -f $cdev || cleanup fdisk_err getactive=`fdisk -p -f $cdev` while [ 0 -eq `expr "$getactive" : '.*UNIX[ ]*Active.*'` ] && getyn "Do you wish to specify an active UNIX partition?" do /etc/fdisk -f $cdev || cleanup fdisk_err getactive=`fdisk -p -f $cdev` done /etc/badtrk -e -f $actdev do echo " Please re-partition your disk, creating the active UNIX partition after the bad area on the disk.\n" done else # do the non-interactive fdisk and badtrk batchfdisk || cleanup batch_fdisk batchbadtrk FULL || { echo " Reboot the system and restart the installation. At the prompt, choose the interactive hard disk initialization. Please re-partition your disk, creating the active UNIX partition after the bad area on the disk. Exiting...\n" >&2 cleanup $FAIL } fi } rundivvy () { divflags="-m" if [ -n "$rootinstall" ] then # all root disks are physical 0 physical=0 # set the divvy root install flag divflags="-i" # set the divvy non-interactive flag here [ -n "$interactive" ] || divflags="$divflags -n" exec=exec else exec= fi [ -n "$interactive" ] || echo " Dividing UNIX partition into filesystem and swap divisions..." # invoke divvy $exec /etc/divvy $divflags $cdev || error divvy_err } # prevent confusion over selecting 'q' in the middle of the disk installation utilmsg () { echo "\nThe hard disk installation program will now invoke $1.\ \nEntering 'q' at the following menu will exit $1,\n\ and the hard disk installation will continue. \ \n\nIf you wish to exit the entire installation at this menu,\n\ press the key.\n" } rundparam () { # if root disk on SCSI or OMTI controller, need to dparam -w if [ "$newtype" = "S" -o "${newtype}$arch" = "EAT" ] then [ "$rootinstall" ] && dparam -w fi # invoke dkinit for ST506 and IDA and ESDI disks if [ "$newtype" = "W" -o "$newtype" = "I" -o "${newtype}$arch" = "EMC" ] then if [ -n "$interactive" ] then # use dkinit if interactive [ -f "$dkconf" ] && { echo $newtype $ctrlnum $drivenum $disknum >> $dkconf } utilmsg "/etc/dkinit" dkinit $drivenum $ctrlnum $newtype else # write masterboot out only if noninteractive dparam -w fi fi } # run fdisk non-interactively # WARNING: this will delete every existing NON-DOS virtual drive, # then create a single active UNIX virtual drive. # Don't try this at home, kids. batchfdisk() { # we now cycle through 4 partitions and delete the next UNIX # or XENIX partition. This depends on fdisk -p putting the # partition number as the very first character in its output. # We used to assume partitions would "bubble up" so we could # always delete the first one, but the DOS would stay at entry # 4. This is no longer a valid assumption. fdisk -p | while read part do set `echo $part` if [ "$5" = "UNIX" -o "$5" = "XENIX" ] then fdisk -d $1 -f $cdev > /dev/null 2>&1 break fi done # now create the single, active UNIX virtual drive echo "Creating UNIX partition..." fdisk -c 1 - - -f $cdev || return $FAIL # now make the single partition active fdisk -p | while read part do set `echo $part` if [ "$5" = "UNIX" -o "$5" = "XENIX" ] then fdisk -a $1 -f $cdev > /dev/null 2>&1 || return $FAIL break fi done # return and let the calling statement know everything is OK return $OK } # run badtrk non-interactively # This will use a destructive, thorough scan by default, and # will reserve N tracks for future badtracks # argument indicates that actual badtracking is to be done # (not just make space for future badtracks) batchbadtrk() { badtrkargs="-e -v" [ "$1" = "FULL" ] && { badtrkargs="-e -v -s td" echo "Scanning disk..." } # get the number of tracks in the virtual drive # we will use roughly 8 percent of the total disk set `fdisk -p` maxtracks=`expr $4 / $diskpercent` # do the non-interactive scan badtrk $badtrkargs -m $maxtracks -f $actdev || return $FAIL return $OK } error () { case $1 in bad_arg) a="Command line argument is invalid.\nInvoke mkdev hd -u\ for a usage message." ;; esdi_one) a="Can't add a second ESDI controller." ;; esdi_add) a="Can't add an ESDI controller to ST506 or SCSI system.";; st506_add) a="Can't add an ST506 controller to ESDI or SCSI system.";; st506_mca) a="Can't add a second ST506 controller on an MCA system.";; scsi_omti) a="Can't add a SCSI controller to an OMTI system." ;; esdi_disk) a="ESDI controllers support only disks 0 and 1." ;; st506_disk) a="ST506 controllers support only disks 0 and 1." ;; no_sed) a="/bin/sed is not installed. Install it and \ reinvoke mkdev." ;; divvy_err) a="divvy could not divide $cdev." ;; root_fail) a="Cannot determine root hard disk type." ;; link_fail) a="custom failed to install Link Kit successfully. Please\ try again." ;; mknod_fail) a="idmknod could not create device nodes." ;; scsi_noconfig) a="Incomplete or incorrect scsi device configuration." ;; root_ida) a="Cannot configure root hard disk. Drive 0, controller 0 in use by primary IDA controller. If you want to add an ST506 controller to a system with a primary IDA controller, it must be the second controller." esac echo "\nError: $a\nInstallation exiting." cleanup $FAIL } quitnow () { echo "\nDuring installation you may choose to overwrite all or part of the present contents of your hard disk." while echo "\nDo you wish to continue? (y/n) \c" do read x case $x in [Yy]*) return $OK ;; [Nn]*) echo "\nAborting initialization procedure.\n" cleanup $FAIL ;; *) echo "\nPlease enter either 'y' or 'n'.\n" ;; esac done } get_ndisk() { ndisk= olddir=`pwd` [ -d /etc/conf/cf.d -a -x /etc/conf/cf.d/configure ] \ && cd /etc/conf/cf.d || return $FAIL ndisk=`./configure -y NDISK` || { cd $olddir return $FAIL } cd $olddir return $OK } conf_ndisk() { get_ndisk [ -z "$ndisk" ] && return new_ndisk=`expr $disknum + 1` export new_ndisk [ $new_ndisk -gt $ndisk ] && { echo "\nIncreasing kernel parameter NDISK from $ndisk to $new_ndisk" (cd /etc/conf/cf.d; ./configure NDISK=$new_ndisk) relink=`expr $relink + 1` } } major_to_driver() { line=`grep "[a-zA-Z][^ ]* $major $major " $mdev | head -1` driver=`expr "$line" : "\([^ ]*\)"` } driver_to_major() { line=`grep "^$driver" $mdev | head -1` major=`echo "$line" | awk '{print $6}'` } #Are we on an EISA bus machine? is_eisa() { set -- `uname -X | grep BusType` [ "$3" = "EISA" ] && return 0 return 1 } : # @(#) hd.sh 23.9 91/11/22 # # Copyright (C) 1987-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # mkdev/hd - Hard Disk Configuration # # set the standard exit values : ${OK=0} ${FAIL=1} ${STOP=10} # set the environment variables PATH=/etc:/bin:/usr/bin export PATH umask 0 #Hooks for IDA Driver #disk type 'I' indicates an IDA driver IDASCRIPT=/usr/lib/mkdev/ida #pick up 'mkdev hd' back-end functions . /usr/lib/mkdev/.hdfuncs # cd to root cd / # mkdev hd functions # set a trap so that if the user dels out, a value of $STOP # is passed to the calling program settrap() { if [ -n "$interactive" ] then trap 'echo Installation interrupted. >&2 cleanup $FAIL' 1 2 3 15 else trap 'cleanup $FAIL' 1 2 3 15 fi } # unset the traps unsettrap() { trap '' 1 2 3 15 } get_args () { case ${rootdisk}$arch in WAT|WMC|IAT) case ${rootdisk} in W) echo "\nYour root hard disk is attached to an ST506 controller." ;; I) echo "\nYour root hard disk is attached to an IDA controller." ;; esac mesg="Pick one of the choices below or you may quit and invoke mkdev hd -u for a detailed usage message. 1) Add a hard disk to ST506 controller 2) Add a hard disk to SCSI controller 3) Add a hard disk to an IDA controller (EISA).\n Enter 1, 2, 3 " while : do prompt || { cleanup $FAIL } case $cmd in 1) newtype=W case $arch in AT) get_drivenum get_ctrlnum ;; MC) drivenum=1 ctrlnum=0 major=1 ;; esac break;; 2) newtype=S break;; 3) exec $IDASCRIPT echo "\nPlease enter 1 or 2 (or 'q' to quit)";; *) echo "\nPlease enter 1 or 2 (or 'q' to quit)";; esac done ;; EAT) echo "\nYour root hard disk is attached to an OMTI controller." if getyn "The only available choice is to add one other hard disk.\n\ Enter 'y' to add another disk. If you enter 'n' you will exit\nthis \ script. You may then invoke mkdev hd -u for a detailed\nusage message." then newtype=E drivenum=1 ctrlnum=0 major=1 else cleanup $FAIL fi ;; EMC) echo "\nYour root hard disk is attached to an ESDI controller." mesg="Pick one of the choices below or you may quit and invoke mkdev hd -u for a detailed usage message. 1) Add a hard disk to ESDI controller 2) Add a hard disk to SCSI controller Enter 1, 2 " while : do prompt || { cleanup $FAIL } case $cmd in 1) newtype=E drivenum=1 ctrlnum=0 major=1 break;; 2) newtype=S break;; *) echo "\nPlease enter 1 or 2 (or 'q' to quit)";; esac done ;; SAT|SMC) echo "\nYour rootdisk is attached to a SCSI controller." if getyn "The only available choice is to add another SCSI disk.\n\ Do you want to add another SCSI disk?" then newtype=S else cleanup $FAIL fi ;; esac } # this function used when adding ST506 or ESDI disks get_drivenum () { while [ "$drivenum" != "0" -a "$drivenum" != "1" ] do echo "\nWill this disk be the first or second disk on this controller?" echo "Enter 1 (first) or 2 (second): \c" read num case $num in 1|2) drivenum=`expr $num - 1` ;; q|Q) cleanup $FAIL ;; *) echo "Error. Not a valid number. Try again" ;; esac done } # this function used only when adding ST506 disks get_ctrlnum () { while [ "$ctrlnum" != "0" -a "$ctrlnum" != "1" ] do echo "\nWill this disk attach to the first or second ST506 controller?" echo "Enter 1 (first) or 2 (second): \c" read cnum case $cnum in 1) ctrlnum=`expr $cnum - 1` major=1 ;; 2) ctrlnum=`expr $cnum - 1` major=54 ;; q|Q) cleanup $FAIL ;; *) echo "Error. Not a valid number. Try again" ;; esac done } scsi_config () { #check that disk if configured and add if necessary to mscsi #.scsi writes to filedes 3: 1) SCSI index to use and 2) 'a' if added /bin/sh /usr/lib/mkdev/.scsi -n -a -C -d $HA $ID $LUN $HATYPE 3>${tmp}4.$$ scsi_ret=$? set -- `cat ${tmp}4.$$` scsi_index=$1 [ "$scsi_index" -eq -1 ] && error scsi_noconfig #was it already configured? [ "$2" != "added" ] && return 0 [ $scsi_ret = 0 ] && { relink=`expr $relink + 1 ` return 0 } rm -f ${tmp}4.$$ cleanup $FAIL } # get the major number associated with the scsi entry scsi_major () { if [ "$rootdisk" = "S" ] then driver=hd else driver=Sdsk fi driver_to_major } # usage and help usage () { echo " Usage: $0 drivenum ctrlnum [ lun [ hatype ] ] [-nhu ] -u display this usage message -h display usage message for combining disk interfaces -n means initialize the disk non-interactively using system defaults. This may only be done when installing the root hard disk (when drivenum is 0 and ctrlnum is 0; for SCSI disks, lun is not specified and defaults to 0) The arguments 'drivenum', 'ctrlnum' and 'lun' are dependent on the type of hard disk being installed. The arguments 'lun' and 'hatype' apply to SCSI disks only. SCO System V supports four different hard disk interfaces -- ST506 (standard), ESDI, IDA (EISA), and SCSI. Following is a section describing installation of each of these. Please note: ST506 and SCSI interfaces may be combined on the same system. ESDI and SCSI interfaces may also be combined on an MCA system. To view a guide to selecting mkdev hd arguments when combining these interfaces, enter \"mkdev hd -h\" at a shell prompt." echo "\nPress return to continue: \c" read x echo "\n Installation of a disk on to an ST506 controller ------------------------------------------------ drivenum is the number of the disk drive. The first disk on a controller is disk 0; the second disk is disk 1. ctrlnum is the controller number. Two controllers are supported. The first controller is ctrlnum 0. It may also be referred to as \"ST506-0\". The second controller is ctrlnum 1. It may be also be referred to as \"ST506-1\". On an MCA system, only the first controller \"ST506-0\" is supported. ST506 disks will install with one of the following commands: mkdev hd 0 0 (or ST506-0) for the first disk on first controller (root) mkdev hd 1 0 (or ST506-0) for the second disk on first controller mkdev hd 0 1 (or ST506-1) for the first disk on second controller (not MCA) mkdev hd 1 1 (or ST506-1) for the second disk on second controller (not MCA) NOTE: Some ST506 controllers may support ESDI interface disks." echo "\nPress return to continue: \c" read x echo "\n Installation of a disk on to an OMTI or ESDI controller ------------------------------------------------------- drivenum is the number of the disk drive. The first disk on the controller is disk 0. The second disk is disk 1. ctrlnum is the controller number. One controller is supported. The ctrlnum is always 0. It may be referred to as \"OMTI-0\", or as \"ESDI-0\". ESDI disks will install with one of the following commands: mkdev hd 0 0 (or OMTI-0, or ESDI-0) for the first disk on the controller (root) mkdev hd 1 0 (or OMTI-0, or ESDI-0) for the second disk on the controller NOTE: Some OMTI controllers may support standard interface disks." echo "\nPress return to continue: \c" read x echo " Installation of a SCSI disk on to a SCSI bus -------------------------------------------- drivenum is the ID number of the controller for this disk. The ID number is determined by jumper settings. Valid ID numbers are 0-7. ctrlnum is the host adapter number. Multiple host adapters are supported. The first host adapter is \"SCSI-0\". The second host adapter is \"SCSI-1\", etc. lun Most SCSI disks are manufactured with a controller embedded in the same physical unit as the disk. These controllers support only one disk. In this case the lun (logical unit number) is 0. The lun argument is optional. If not specified, it will default to 0. If you have a non-embedded controller, you must set the lun for each device, via jumper settings. Valid lun numbers are 0-7. hatype is the type of SCSI host adapter referenced by ctrlnum." echo "\nPress return to continue: \c" read x echo " Invoke mkdev hd with the correct numbers as follows: mkdev hd [0-7] [SCSI-x] [0-7] [hatype] Please note: This program 'mkdev hd' must be invoked twice to install a SCSI disk. The first time, the kernel will be reconfigured to support the new disk. The second time, the disk will be initialized. Use the same mkdev hd arguments both times.\n" echo "\nPress return to continue: \c" read x echo "\n Installation of a disk on to a IDA (Intelligent Disk Array) controller ---------------------------------------------------------------------- drivenum is the logical number of the disk drive. The first disk array on a controller is disk 0; the second disk is disk 1. ctrlnum is the controller number. Six controllers are supported. The first controller is ctrlnum 0, the second controller is ctrlnum 1 and so on. These may also be referred to as \"IDA-0\", \"IDA-1\" and so on. IDA disks will install with one of the following commands: mkdev hd 0 0 (or IDA-0) for the first disk on first controller mkdev hd 1 0 (or IDA-0) for the second disk on first controller mkdev hd 0 1 (or IDA-1) for the first disk on second controller mkdev hd 1 1 (or IDA-1) for the second disk on second controller \n" cleanup $OK } combo_help () { echo " Combining Hard Disk Interfaces ------------------------------ SCSI hardware may be added on to a system that has a root hard disk attached to an ST506 controller. On an MCA system, SCSI hardware may also be added when the root hard disk is attached to an ESDI controller. The addition of ST506 or ESDI disks on to a system with a SCSI root disk is not supported. Adding ST506 or ESDI disks to a combination system is identical to adding them to a simple system. Invoke 'mkdev hd -u' for more information. Adding SCSI disks to a combination system is accomplished by invoking mkdev hd with the arguments 'drivenum', 'ctrlnum', 'lun' and 'hatype' The first argument, 'drivenum', is the disk number. Choices for 'drivenum' are identical to the choices on a SCSI-only system. Invoke 'mkdev hd -u' for further information." echo "\nPress return to continue: \c" read x echo " The second argument, 'ctrlnum', must be in the following format: \"SCSI-0\" -- for the first SCSI Host Adapter \"SCSI-1\" -- for the second SCSI Host Adapter \"SCSI-n\" -- for the nth SCSI Host Adapter The third argument 'lun', is optional. Selection of this argument is identical to selection of it when installing on a SCSI-only system. Invoke 'mkdev hd -u' for more information. The fourth argument 'hatype', is optional. This is the prefix of the SCSI host adapter driver used to control 'ctrlnum'. To specify a hatype, you must give a complete command line including id, ctrlnum, id, and hatype. Example: Adding a SCSI disk to the first SCSI host adapter on a combination system. If disk ID is 0, and the disk is being attached to the first SCSI host adapter, and the lun is 0, enter: mkdev hd 0 SCSI-0 0\n" cleanup $OK } do_relink() { [ $relink -lt 1 ] && return if getyn "A new kernel must be built and rebooted before disk \ configuration can continue. Would you like to relink at this time?" then ( cd /etc/conf/cf.d; ./link_unix ) else echo "\nYou must build a new kernel before proceeding with \ further configuration\nof this disk." fi echo "\nAfter the system is rebooted with the new kernel, reinvoke mkdev hd to initialize the new hard disk.\n" exit $? } makeroothd() { # figure out hard disk type get_root_type # chance to bail out [ "$interactive" ] && quitnow # run dparam; invoke dkinit if it's an ST506 disk rundparam # fdisk for all, and badtrack for ST506 disks diskprep # divide the disk into file systems rundivvy # NOTE: when making the root hard disk, rundivvy execs divvy # and so never returns here: the lines that follow are for # reference only, they are actually done by inst2/rootfiles # copy boot sector out to active partiton dd if=/etc/hdboot0 of=/dev/hd0a 2> /dev/null dd if=/etc/hdboot1 of=/dev/hd0a bs=1k seek=1 2> /dev/null } makenonroothd() { # if SCSI, verify that SCSI kernel configuration includes this disk [ "$newtype" = "S" ] && { scsi_config # get major number of SCSI driver from mdevice scsi_major } # set minor numbers set_minors # determine disk number for use in perms list set_disknum # make sure NDISK is big enough conf_ndisk # do we need a relink/reboot before we can talk to the device? do_relink # last chance to bail out quitnow # create devices fix # get disk parameters; if ST506/ESDI disk, call dkinit rundparam # fdisk for all, and badtrack for ST506/ESDI disk diskprep # divide the disk into file systems rundivvy echo "\nHard disk initialization procedure completed.\n" } #### begin main #### if cat /dev/mcapos 1>/dev/null 2>/dev/null then arch=MC else arch=AT fi # ROOT INSTALL CASE if [ "$1" = "0" -a "$2" = "0" ] then if [ "$3" = "-n" ] then interactive= elif [ "$3" ] then error bad_arg fi ctrlnum=0 drivenum=0 disknum=0 major=1 rootinstall=TRUE makeroothd cleanup $OK fi # NON-ROOT INSTALL CASE case "$#" in 0) no_args=true # Get root hd type to prompt them for valid choices get_root_type get_args ;; 1) case $1 in -u) usage ;; -h) combo_help ;; *) error bad_arg ;; esac ;; 2|3|4) # make sure sed is installed for use by this script [ -x "/bin/sed" ] || error no_sed # Save command line args argv=$* # Find out root hd type to make sure their input is valid get_root_type set $argv case "$2" in ST506-0|ST506-1) newtype=W ;; OMTI-0|ESDI-0) newtype=E ;; SCSI-[0-9]) newtype=S ;; IDA-[0-9]) newtype=I ;; [0-9]) newtype=$rootdisk ;; *) error bad_arg ;; esac case "$2" in *[0-9]) ctrlnum=`expr "$2" : '.*\(.\)$'` ;; esac case ${newtype}$3 in S) LUN=0 ;; S[0-7]) LUN=$3 ;; E|W|I) ;; *) error bad_arg ;; esac [ $# -eq 4 ] && { case $newtype in S) HATYPE=$4 ;; *) error bad_arg;; esac } case ${newtype}$1 in S[0-7]) ID=$1 HA=$ctrlnum ;; E0|W0) drivenum=0 ;; E1|W1) drivenum=1 ;; E*) error esdi_disk ;; W*) error st506_disk ;; I*) drivenum=$1 ;; *) error bad_arg ;; esac major=1 case ${rootdisk}${newtype} in SS) ;; SE) error esdi_add ;; SW) error st506_add ;; ES) [ $arch = AT ] && \ error scsi_omti ;; EE) [ $ctrlnum -eq 0 ] || \ error esdi_one ;; EW) error st506_add ;; WS) ;; WE) error esdi_add ;; WW) [ $ctrlnum -eq 0 ] || { if [ $arch = AT ] then major=54 else error st506_mca fi } ;; # IDA disks ?I) exec $IDASCRIPT $drivenum $ctrlnum;; IE) ;; #ok? IS) ;; IW) [ $ctrlnum -eq 0 ] && error root_ida esac # set the traps settrap ;; *) error bad_arg ;; esac #need link-kit for node.d, idmknod and mscsi files check_link makenonroothd cleanup $OK [.P..\a\.[..]ansi]ansi80x25]ansic^ansi_ncc^ansi80x25_ncc+%kXansi|ansic|ansi80x25|Ansi standard consoleP@HLNPX_fw{  !%'HLPT?5+ansi|ansic|ansi80x25|Ansi standard console[4%p1%dm[3%p1%dm [%i%p1%d;%p2%dH[@ 0[a1fxgqh2jYk?lZm@nEqDtCu4vAwBx3,%k<ansi_ncc|ansi80x25_ncc|Ansi No Color ChangePkioaq$MRW\*/4 , ansi_ncc|ansi80x25_ncc|Ansi No Color Change0[a1fxgqh2jYk?lZm@nEqDtCu4vAwBx3 [%i%p1%d;%p2%dH [@: # @(#) instscript 25.1 93/02/24 # # Copyright (C) 1988-1993 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # instscript # # This runs every script found in /inst[1-9], # and is itself run by /etc/bcheckrc, the first entry in /etc/inittab. # : ${OK=0} ${FAIL=1} ${STOP=10} ${HALT=11} ${STOP2=20} ${UP=21} PS1=" " HZ=100 OANOCOLOR= OALIB=/usr/lib/sysadm OASH=/bin/oash OASHFUNCS=/usr/lib/oash/oafuncs PATH=/etc:/bin:/usr/bin LANG=english_us.ascii # File containing haltsys message haltmsgfile=/tmp/haltmsg # Haltsys messages: haltmsg1=" The system will now be rebooted to use the selected medium. After the \"Power Off or Reboot\" prompt is displayed, \t1. remove the N2 (Filesystem) floppy from the drive, \t2. insert the N1 (Boot) floppy, (the drive light may stay on), \t3. close the drive door, then press any key. The screen will clear and display the \"Boot:\" prompt." haltmsg2="\nInstallation aborted. After the \"Power Off or Reboot\" prompt is displayed, you may power down the system if required. To resume the installation procedure from the aborted point, \t1. insert N1 (Boot) floppy in the drive, \t2. close the drive door, then press any key. The screen will clear and display the \"Boot:\" prompt." haltmsg3=" After the \"Power Off or Reboot\" prompt is displayed, you may power down the system if required. To resume the installation procedure from the aborted point, \t1. insert N1 (Boot) floppy in the drive, \t2. close the drive door, then press any key. The screen will clear and display the \"Boot:\" prompt." haltmsg4=" Installation and configuration of the System V Operating System is now complete. After the \"Power Off or Reboot\" prompt is displayed, reboot the system from the hard disk by removing the floppy from the drive and pressing any key. The screen will clear and display the \"Boot:\" prompt." haltmsg5=" Update aborted. After the \"Power Off or Reboot\" prompt is displayed, return to the presently installed system by removing the floppy from the drive and pressing any key. The screen will clear and display the \"Boot:\" prompt." haltmsg6=" The Update installation will be completed by executing fsck on the root filesystem. After this, the system will automatically reboot the updated system from the hard disk.\n" interrupted() { rm -f /tmp/*.ser 2> /dev/null [ "$hdroot" ] || umount /dev/ropipe 2> /dev/null echo "$haltmsg2" /etc/haltsys } do_reboot() { rm -f /tmp/*.ser 2> /dev/null [ -s $haltmsgfile ] && cat $haltmsgfile || echo "$haltmsg3" /etc/haltsys } colorset() { # first use ANSI sequence to get immediate color display # (do background first, to make a solid color bar) ansibg="" # blue {ANSI} ansifg="" # white + bold (= lt_white) {ANSI} # then use SCO extended sequence to get it to "stick" (console bug) scobg="[=1G" # blue {SCO} scofg="[=15F" # lt_white {SCO} # now set the border to match the background border="[=1A" # blue # now set reverse and graphics colors (all SCO extended) revfg="[=0H" # black reverse foregrnd revbg="[=11I" # lt_cyan reverse backgrnd grfg="[=11J" # lt_cyan graphic foregrnd grbg="[=1K" # blue graphic backgrnd # jam it all out there now: echo "$ansibg$ansifg$scobg$scofg$border$revfg$revbg$grfg$grbg" } do_wait_rewind() { # This function waits for the tape to finish rewinding # if it was started in the background. # This is necessary because if a haltsys occurs whilst the # tape is rewinding then the root filesystem is left unclean [ -f /tmp/rewind.start ] && { while [ ! -f /tmp/rewind.end ] do sleep 1 done rm -f /tmp/rewind.* } } # Message for the user to let them know we are working. # Put it out each time we reboot, but don't put it out if # we've just chrooted (inheriting environment e.g. _RELINK). [ "$_RELINK" ] || echo "Setting installation display environment ..." _RELINK=deferred umask 027 export PS1 HZ PATH LANG _RELINK OANOCOLOR # set a trap in case they interrupt the installation: # instruct the user what to do to restart the installation # from where it left off trap 'interrupted' 1 2 3 15 # look for the hdisk directory, which is only present # on the floppy root: if it is NOT present, set hdroot. [ -d /hdisk ] && hdroot= || hdroot=yes if [ ! "$hdroot" ] then # note: the pipe filesystem is the bottom half of the swap ramdisk etc/fscmd.d/S51K/mkfs -y /dev/ropipe 32:16 1 1 > /dev/null 2>&1 mount -f S51K /dev/ropipe /tmp > /dev/null 2>&1 # perform pipeflip so that pipe is on newly created ram disk pipe -s /tmp case `cat /dev/string/boot /dev/string/cfg` in *systty=sio*) ;; *%console*) echo "TERM=ansi; export TERM" > /tmp/termtype ;; esac echo "stty erase '^h' intr '^?' echoe" >> /tmp/termtype else ver=`cat /tmp/system_upgrade 2>/dev/null` if [ "$ver" = "v2" ] then # avoid unreferenced file warning from Update's final fsck -E: # make a second link to inittab before anything messes with it rm -f /etc/inittab.inst ln /etc/inittab /etc/inittab.inst fi fi [ "$TERM" ] || { [ -f /tmp/termtype ] && . /tmp/termtype [ "$TERM" = "ansi" ] && colorset } [ "$TZ" ] || { [ -f /etc/TIMEZONE ] && . /etc/TIMEZONE } # do each of the directories in turn for directory in /inst1 /inst2 /inst3 /inst4 /inst5 /inst6 /inst7 /inst8 /inst9 do [ -d "$directory" ] && { # do each script in turn for script in $directory/* do ( ln -f /bin/true /bin/telinit ) 2>/dev/null # if script is not executable, skip and continue [ -f "$script" -a -x "$script" ] || continue status=$OK # Warning! This is a hardwired special case: # If user hits delete at choose-a-password prompt # in inst6/password, we catch it and force them to # pick a password. This script gets that interrupt, # too, so we have to unset our trap, in order for # the installation to successfully complete [ "$script" = "/inst4/setterm" ] && trap '' 1 2 3 15 [ "$script" = "/inst5/customize" ] && trap '' 1 2 3 15 [ "$script" = "/inst6/newsys" ] && trap '' 1 2 3 15 [ "$script" = "/inst6/password" ] && trap '' 1 2 3 15 if [ -x $OASH ] then export OALIB OASH OASHFUNCS $OASH $script else $script fi status=$? sync [ -f /etc/TIMEZONE ] && . /etc/TIMEZONE [ -f /tmp/termtype ] && . /tmp/termtype case $status in $OK) # all is well, go on to the next one # remove the script if hdroot is set [ -n "$hdroot" ] && rm -f $script 2> /dev/null sync ;; $FAIL) # the script failed! echo " The $script installation program has failed. Contact your Support Representative if you require assistance." interrupted ;; $STOP) # the user del'ed out of the script. echo " The $script installation program has been interrupted." interrupted ;; $STOP2) # the user quit from an Update prompt echo "$haltmsg5" ( ln -f /etc/init /bin/telinit ) 2>/dev/null rm -f /etc/inittab.inst rm -f /tmp/*.ser 2> /dev/null /etc/haltsys break 2 ;; $UP) # Update completed successfully do_wait_rewind ver=`cat /tmp/system_upgrade` if [ $ver = "v2" ] then echo "$haltmsg6" echo "\nRemove the floppy disk from the drive and press : \c" read anykey ln -f /etc/init /bin/telinit 2>/dev/null rm -fr /inst? 2> /dev/null rm -f /tmp/*.ser 2> /dev/null rm -f /tmp/system_upgrade rm -f /tmp/history.up rm -f /etc/default/boothd* chmod a-x /instscript sync sync /etc/fsck -y -E -b /dev/root /etc/haltsys else ln -f /etc/init /bin/telinit 2>/dev/null rm -fr /inst? 2> /dev/null rm -f /tmp/*.ser 2> /dev/null rm -f /tmp/system_upgrade rm -f /tmp/history.up rm -f /etc/default/boothd* rm -f /instscript echo "\nUpdate completed.\n" /etc/haltsys fi break 2 ;; $HALT) # the script has relinked the kernel, we need # to reboot. # remove the script if hdroot is set [ -n "$hdroot" ] && rm -f $script 2> /dev/null do_reboot ;; *) # all other unknown script exit codes. echo " The $script installation program has exited with an unknown status." interrupted ;; esac done } done if [ -n "$hdroot" ] then # do cleanup if the files are there and hdroot is set do_wait_rewind ln -f /etc/init /bin/telinit 2>/dev/null rm -fr /tmp/* 2> /dev/null rm -fr /inst? 2> /dev/null # if there is a save dir, copy everything over to root [ -d "/save" ] && copy -mr /save / rm -f /etc/default/boothd* rm -f /instscript echo "$haltmsg4" else umount /dev/ropipe 2> /dev/null mount /dev/hd0root /mnt > /dev/null 2>&1 if [ -f /mnt/tmp/config_boot ] then umount /dev/hd0root 2> /dev/null echo "$haltmsg1" else pipe -s /mnt/tmp swap -a /mnt/dev/swap 0 0 # kernel will set nswap exec chroot /mnt /bin/sh /instscript \ /mnt/dev/console 2>&1 echo "$haltmsg2" # should never get here! fi fi # halt the system /etc/haltsys ./etc/TIMEZONE ./etc/default/tape ./etc/default/tar ./etc/default/format ./etc/group ./etc/inittab ./etc/passwd ./etc/termcap ./tcb/files/auth/r/root # @(#) boothd 23.7 91/10/28 # # Copyright (C) 1989-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # /etc/default/boot - default boot file: floppy boot, hdisk root # for UNIX System V/386 Release 3.2 Operating System # # nswap and swplo are set in the hd driver DEFBOOTSTR=fd(64)unix root=hd(40) swap=hd(41) RESTART=fd(64)unix root=fd(96) swap=ram(8) swplo=32 nswap=32 ronly prompt="Insert N2 (Filesystem) floppy and press " mem=/p LOADXENIX=NO FSCKFIX=YES MULTIUSER=NO PANICBOOT=NO MAPKEY=NO Lg+ p p@.textpppp .data@@@.bss@@ .fka000C".fka040@@LB.fka041L@L@.comment".lib@L@@@@@ @#@$@P@(@@,@@@ @@D@4@0@%@8@@ÐET@RU RPWh@jL@ PjU@VEE EEE8/uEEċE8uEĀ8uu*}E pv 9j|EMtE E 8-t }tMAE xru MѐE 0~f~t FE뱐ME E }tFh@uX th@uD uE@ujEЉEMEjEE&uj(EPE 0I uEȉEEȋE9E~jjuEűE p0 | jM=L@uuhL@hp@ u@jEĀ8uu j#h@ j/h@j j^ÐUV@=L@|@9L@} L@4@}tE8tPh|@hp@ 5L@V@u @@Php@^Ð,3ÐÐ#3ÐTÐ3ÐT$ÐUu1@u3Uu@u3ÐEÐU=@ uÐ@M @@3ÐUV5@Ny^Ð@Ny^ÐEAFSS51Kusage: umount special-or-directory usage: mount [-r] [-f fstyp] special directory %s: possibly damaged file system, mount failed %s: %s %d %s Error@ @ @( @8 @P @\ @x @ @ @ @ @ @ @ @ @$ @0 @< @P @` @p @ @ @ @ @ @ @ @ @ @0 @@ @L @d @x @ @ @ @ @ @ @ @< @X @h @ @ @ @ @ @ @ @ @( @< @L @d @| @ @ @ @ @ @ @@@0@H@X@h@@@@@@@@@@ @(@H@`@@@@@8@D@`@x@@@@@@(@@@\@@@@@@@0@T@x@@@@@@@4@H@X@l@@@@@@@@@@@@@@ @,@8@D@`@l@|@@@@@@@@@@ @@$@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in path ((((( H #@#@@#@@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_s# @(#) termcap.fl 23.1 91/08/29 # # Copyright (C) 1989-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # SCO Termcap File for use during installation (very slim version) # based on termcap.src 2.1 89/03/01 # li|ansi|ansi80x25|Ansi standard crt:\ :al=\E[L:am:bs:cd=\E[J:ce=\E[K:cl=\E[2J\E[H:cm=\E[%i%d;%dH:co#80:\ :dc=\E[P:dl=\E[M:do=\E[B:bt=\E[Z:ei=:ho=\E[H:ic=\E[@:im=:li#25:\ :nd=\E[C:pt:so=\E[7m:se=\E[m:us=\E[4m:ue=\E[m:up=\E[A:\ :k1=\E[M:k2=\E[N:k3=\E[O:k4=\E[P:k5=\E[Q:k6=\E[R:\ :k7=\E[S:k8=\E[T:k9=\E[U:k0=\E[V:\ :kb=^h:ku=\E[A:kd=\E[B:kl=\E[D:kr=\E[C:eo:sf=\E[S:sr=\E[T:\ :mb=\E[5m:md=\E[1m:me=\E[m:\ :GS=\E[12m:GE=\E[10m:GV=\63:GH=D:\ :GC=E:GL=\64:GR=C:RT=^J:G1=?:G2=Z:G3=@:G4=Y:G5=;:G6=I:G7=H:G8=<:\ :GU=A:GD=B:\ :CW=\E[M:NU=\E[N:RF=\E[O:RC=\E[P:\ :WL=\E[S:WR=\E[T:CL=\E[U:CR=\E[V:\ :HM=\E[H:EN=\E[F:PU=\E[I:PD=\E[G:\ :Gc=N:Gd=K:Gh=M:Gl=L:Gu=J:Gv=\072: LP+  0ph@.textpp p .datah@h@h"@.bss\@\@0.fka000C".fka040@@LB.fka041L@L@.comment"\>.lib~>@@4@0@4@8@i@@*@@.@ @2@$@ @(@@,@@@ @@@ÐETi@RU RPWhh@jL@] PtjUEEEE8uEM ~ME8/uEEÐMU WVEE 0Ejh4@P h(@E E 0@u+E 0h<@Pp Pv7o E8tE 0uhT@ E 0h\@EMzuNEft`it;ltJttYvth@h@@j뿐|*@t*@5|*@*@!*@x*@ |*@ht@u u E@ih*@ uh|@h@@jj~=t*@t=*@u h@=*@t=t*@u h@=*@E=t*@8h,@&=*@t Eh (@P@u f (@@@9EEf(@f%f=@uphP P uRh(@EM 4K@u f(@EM <EPWWPEEM j:P EE9E1EM 8th(@E4@u f(@hPEM 4 t%hPEM 4 EPEM 4P+h(@EM 4A@u f(@f(@f%f=@+f (@f9(@f=(@ 뉐h(@P@u f(@EPPPPEjEPhPhP5*@ 5@@&E t+'@P'@'@;wҋE 8rEWuujS, Sjuh@h@h @+ja}'@M Sou W^_[ÐUWV=@u ^_ÐEp P>jjEjjEjjEu =L@uEP'@;$ÐUWVu & u3^_G EG G 3ɉOO @at%rtwt*ÐO ~+ug O ^_jju O א*L$Q3ÐWV|$ t$T$L$I|&:tI|:tI|:t I| :u܋^_3^_Ð#(3Ð$ÐD$Pt$Ð5i@t$ t$  Ð;t3ÐU(WVju } 3^_ÐEPWn |2fEf%f=@u$j_ thLF u%fEf%f=@t L@W두>3FF^_ø3ÐUWVuE~t~~ FEGFF9F|3FF~u+hv 6( F  uEF3^_Ð~~ ^_øQlÐUVuV(;E tFju 69 F^UjjE0 u3ÐE@MA E@ø?ÐL$tÐ0!NL$0!:L$0+L$0L$0 L$0cÃQT$6ÐUu1@u3Uu@u3ÐEÐU=X@ uÐX@M @X@3ÐUV5X@Ny^Ð@Ny^Ð)@ (%-10.32s): is not a file system, directory, or mounted resource Usage: df [-tlvi] | [-iv] [-f] [{ }] ... @@@devnmdevnm: cannot open %s%s %s devnm: %s not found itflvdf: cannot open mount table Mount Dir Filesystem blocks used free %%used Mount Dir Filesystem iused ifree itotal %%iused Mount Dir Filesystem blocks used free %%used iused ifree %%iused df: cannot open %s df: cannot stat %s (%-12s): can't determine logical block size df: cannot statfs %s statfs%-8.6s (%-16.32s ): %8ld blocks%c %7u i-nodes %-9s (%-16.32s ): %8ld blocks%c %7u i-nodes %-10s(%-12s ): %8ld blocks total: %8ld blocks %8u i-nodes %-10.10s %-20.20s %9ld %9ld %9ld - %-10.10s %-20.20s %9ld %9ld %9ld %5d%% %-10.10s %-20.20s %9ld %9ld %9ld - %-10.10s %-20.20s %9ld %9ld %9ld %5d%% %-10.10s %-20.20s %6ld %6ld %6ld - %6ld %5ld - %-10.10s %-20.20s %6ld %6ld %6ld %3d%% %6ld %5ld - %-10.10s %-20.20s %6ld %6ld %6ld - %6ld %5ld %4d%% %-10.10s %-20.20s %6ld %6ld %6ld %3d%% %6ld %5ld %4d%% bad free count, b=%ld bad free block (%ld) bread: seek errorbread: read errorread error %x, count = %d /dev/dsk/dev/dev/rdskWARNING: cannot determine current directory /devnm: cannot stat %s swappipeCannot lock temp file %s Out of memory /etc/.mnt.lock/etc/mnttab/usr/nserve/.rmnt.lock/usr/nserve/rmnttabwCannot create %s wCannot create %s rCannot open %s rCannot open %s Out of memory Out of memory Cannot read %s nowherenothing%s: %s %d %s Error @ @ @ @ @ @ @ @4 @H @X @l @ @ @ @ @ @ @ @ @ @ @( @< @P @d @x @ @ @ @ @ @ @ @ @ @<@P@l@@@@@@@@4@P@\@h@t@@@@@@@ @$@0@<@P@d@t@@@@@@@@,@<@H@T@h@t@@@@@@@@0@X@x@@@@@ @<@\@|@@@@@@(@H@x@@@@@@ @<@H@d@|@@@@@@@,@8@D@P@\@h@t@@@@@@@@@@@@@$@4@D@X@d@p@|@@@@@@@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in pathpwd 2>/dev/nullr/bin/shsh-c ((((( H 2@2@@2@@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_s./bin/basename ./bin/cat ./bin/chmod ./bin/cpio ./bin/dd ./bin/dirname ./bin/dparam ./bin/du ./bin/ed ./bin/red ./bin/expr ./bin/line ./bin/mkdir ./bin/rm ./bin/sed ./bin/sh ./bin/rsh ./bin/stty ./bin/STTY ./bin/sync ./bin/true ./bin/i386 ./usr/bin/menu_add ./usr/bin/menu_del ./bin/tset ./etc/TIMEZONE ./etc/badtrk ./etc/bcheckrc ./etc/default/format ./etc/default/mapkey ./etc/default/tape ./etc/default/tar ./etc/divvy ./etc/dkinit ./etc/emulator ./etc/emulator.ms ./etc/fdisk ./etc/fsck ./etc/fscmd.d/S51K/fsck ./etc/fscmd.d/AFS/fsck ./etc/fscmd.d/EAFS/fsck ./etc/fscmd.d/S51K/fsstat ./etc/fscmd.d/AFS/fsstat ./etc/fscmd.d/EAFS/fsstat ./etc/fscmd.d/S51K/mkfs ./etc/fscmd.d/AFS/mkfs ./etc/fscmd.d/EAFS/mkfs ./etc/fsstat ./etc/group ./etc/haltsys ./etc/reboot ./etc/hdboot0 ./etc/hdboot1 ./etc/init ./bin/telinit ./etc/inittab ./etc/ioctl.syscon ./etc/masterboot ./etc/mkfs ./etc/mknod ./etc/mountall ./etc/passwd ./etc/pipe ./etc/scsibadblk ./etc/setmnt ./etc/swap ./etc/ttytype ./etc/uadmin ./etc/umountall ./shlib/libc_s ./shlib/libnsl_s ./usr/bin/compress ./usr/bin/uncompress ./usr/bin/zcat ./usr/bin/getopt ./usr/bin/mapkey ./usr/bin/tar ./usr/bin/tput ./usr/lib/keyboard/fra.ibm ./usr/lib/keyboard/ger.ibm ./usr/lib/keyboard/ita.ibm ./usr/lib/keyboard/spa.ibm ./usr/lib/keyboard/ukd.ibm ./usr/lib/keyboard/usa.ibm ./usr/lib/keyboard/at.ibm.usa ./usr/lib/mkdev/.hdfuncs ./usr/lib/mkdev/hd ./usr/lib/terminfo/a/ansi ./usr/lib/terminfo/a/ansi80x25 ./usr/lib/terminfo/a/ansic ./usr/lib/terminfo/a/ansi_ncc ./usr/lib/terminfo/a/ansi80x25_ncc ./instscript ./rootlist_up ./etc/default/boothd1 ./etc/mount ./etc/umount ./etc/termcap ./bin/df ./etc/devnm ./dev/rct0 ./dev/nrct0 ./dev/erct0 ./dev/xct0 ./dev/rStp0 ./dev/urStp0 ./dev/nurStp0 ./dev/nrStp0 ./dev/xStp0 ./dev/rcdt0 ./dev/nrcdt0 ./dev/xcdt0 ./dev/prf ./dev/string/boot ./dev/string/pkg ./dev/string/cfg ./dev/ecc ./dev/eisa0 ./dev/error ./dev/mcapos ./dev/install ./dev/rinstall ./dev/null ./dev/console ./dev/syscon ./dev/systty ./dev/tty ./dev/tty01 ./dev/hd00 ./dev/hd01 ./dev/hd02 ./dev/hd03 ./dev/hd04 ./dev/hd0a ./dev/rhd00 ./dev/rdsk/0s0 ./dev/rhd01 ./dev/rhd02 ./dev/rhd03 ./dev/rhd04 ./dev/rhd0a ./dev/rdsk/0sa ./dev ./dev/dsk ./dev/rdsk ./dev/string ./lib ./mnt ./tmp ./tmp/disktype ./tmp/termtype f...ginst2g.f..hbootfilesimasterfloppyjextractbtld: # @(#) bootfiles 23.15 91/11/25 # # Copyright (C) 1988-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # bootfiles # # copy files from the N1 boot floppy to the hard disk # For update save contents of boolist files to /tmp/boot.sav # to allow reverting back to old system. # # set the standard exit values : ${OK=0} ${FAIL=1} ${STOP=10} ${STOP2=20} # set the environment variables LANG=english_us.ascii export LANG PATH=/etc:/bin:/usr/bin export PATH restore_old() { echo "\nRestoring previous system ...\c" rm -fr /tmp/sdev.up # Restore device nodes # First move /dev/console to tmp because it is in use mv /dev/console /tmp/.console cd /dev rm -fr ./* cd /tmp/dev.sav /bin/find ./ -print |cpio -pdum /dev >/dev/null 2>&1 # Restore the N02 (rootlist) files cd /tmp/root.sav /bin/find ./ -print |cpio -pdum / >/dev/null 2>&1 # The above command results in cpio not being copied becuase # it is in use so do it here cp /tmp/root.sav/bin/cpio /bin/cpio # Restore perms files mkdir /etc/perms cd /tmp/perms.sav /bin/find ./ -print |cpio -pdum /etc/perms >/dev/null 2>&1 # Tidy up cd / rm -fr /inst? 2>/dev/null rm -fr /hdisk 2>/dev/null rm -fr /tmp/fs.up >/dev/null rm -fr /tmp/dev.sav >/dev/null rm -fr /tmp/root.sav >/dev/null rm -fr /tmp/rootup.sav >/dev/null rm -fr /tmp/upgrade.sav >/dev/null rm -fr /tmp/perms.sav rm -fr /tmp/boot.sav rm -fr /tmp/master.sav >/dev/null rm -fr /tmp/btld >/dev/null rm -fr /tmp/_lbl >/dev/null rm -fr /tmp/perms >/dev/null rm -f /tmp/322drivers rm -f /tmp/system_upgrade rm -f /tmp/_relink rm -f /tmp/fs.xx rm -f /tmp/termtype rm -f /tmp/mediatype rm -f /tmp/config_boot rm -f /rts.savf rm -f /rts.savd rm -f /ext.savf rm -f /ext.savd rm -f /rootlist_up rm -f /rootlist rm -f /bootlist rm -f /sco_devices rm -f /sco_3rd rm -f /sco_extra rm -f /tmp/history.up rm -f /usr/lib/custom/history.0 rm -f /etc/default/boothd* rm -f /instscript # Run fixperm to restore permissions of copied files fixperm /etc/perms/rts* >/dev/null 2>&1 [ -f /etc/perms/inst ] && { fixperm /etc/perms/inst >/dev/null 2>&1 } echo "\nRestoration complete.\n" return $OK } cd / umask 0 # set trap to unmount the floppy if mounted, exit STOP trap 'umount /dev/install 2> /dev/null; exit $STOP' 1 2 3 15 # create /etc/mnttab and /etc/default/filesys so mount doesn't bitch > /etc/mnttab [ -f /tmp/system_upgrade ] || { > /etc/default/filesys } while : do # mount the floppy if mount -f XENIX -r /dev/install /mnt 2> /dev/null then # look for the /bootlist file if [ -f "/mnt/bootlist" ] then # cpio all the files in bootlist [ -f /tmp/system_upgrade ] && { if [ -f /tmp/history.up ] then /bin/grep "$0" /tmp/history.up >/dev/null if [ $? = 0 ] then exit $OK # this script already done fi fi echo "\nSaving files for update ...\c" rm -fr /tmp/boot.sav mkdir /tmp/boot.sav cd / cpio -pdum /tmp/boot.sav /dev/null 2>&1 echo "\n" echo "$0" >>/tmp/history.up # log name of in history } cd /mnt echo "Extracting files ...\c" cpio -pdmu / < /mnt/bootlist > /dev/null 2>&1 cd / umount /dev/install 2> /dev/null echo "" exit $OK else # mountable floppy, but not the right one cd / umount /dev/install 2> /dev/null fi fi echo "\n \007Insert N1 (Boot) floppy in the drive and press or enter q to quit: \c" read answer case "$answer" in 'Q'|'q') [ -f /tmp/system_upgrade ] && restore_old && exit $STOP2 exit $FAIL ;; *) # user wants to try again ;; esac done : # @(#) masterfloppy 23.20 91/12/10 # # Copyright (C) 1989-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # masterfloppy # # Extract the contents of the master floppy # For an update save files listed on master floppy to # /tmp/master.sav, to be used if reverting back to old system # # Status return codes : ${OK=0} ${FAIL=1} ${STOP=10} ${HALT=11} ${STOP2=20} trap 'exit $STOP' 1 2 3 15 PATH=/bin:/usr/bin:/etc export PATH restore_old() { echo "\nRestoring previous system ...\c" rm -fr /tmp/sdev.up # Restore device nodes # First move /dev/console to tmp because it is in use mv /dev/console /tmp/.console cd /dev rm -fr ./* cd /tmp/dev.sav /bin/find ./ -print |cpio -pdum /dev >/dev/null 2>&1 rm -f /bin/oash # Restore the N02 (rootlist) files cd /tmp/root.sav /bin/find ./ -print |cpio -pdum / >/dev/null 2>&1 # The above command results in cpio not being copied becuase # it is in use so do it here cp /tmp/root.sav/bin/cpio /bin/cpio # Restore bootfiles files cd /tmp/boot.sav /bin/find ./ -print |cpio -pdum / >/dev/null 2>&1 # Restore perms files cd /etc/perms rm -fr ./* cd /tmp/perms.sav /bin/find ./ -print |cpio -pdum /etc/perms >/dev/null 2>&1 # Restore the M01 (master floppy) files if it was extracted if [ -d /tmp/master.sav ] then cd /tmp/master.sav /bin/find ./ -print |cpio -pdum / >/dev/null 2>&1 fi rm -fr /usr/lib/custom/fix [ -d /usr/lib/custom/fix.sav ] && \ mv /usr/lib/custom/fix.sav /usr/lib/custom/fix # Tidy up cd / rm -fr /inst? 2>/dev/null rm -fr /hdisk 2>/dev/null rm -fr /tmp/fs.up >/dev/null rm -fr /tmp/dev.sav >/dev/null rm -fr /tmp/root.sav >/dev/null rm -fr /tmp/rootup.sav >/dev/null rm -fr /tmp/upgrade.sav >/dev/null rm -fr /tmp/perms.sav rm -fr /tmp/boot.sav rm -fr /tmp/master.sav >/dev/null rm -fr /tmp/btld >/dev/null rm -fr /tmp/_lbl >/dev/null rm -fr /tmp/perms >/dev/null rm -f /tmp/322drivers rm -f /tmp/system_upgrade rm -f /tmp/_relink rm -f /tmp/fs.xx rm -f /tmp/termtype rm -f /tmp/config_boot rm -f /rts.savf rm -f /rts.savd rm -f /ext.savf rm -f /ext.savd rm -f /rootlist_up rm -f /rootlist rm -f /bootlist rm -f /sco_devices rm -f /sco_3rd rm -f /sco_extra rm -f /tmp/settime rm -f /tmp/oatic rm -f /tmp/history.up rm -f /usr/lib/custom/history.0 rm -f /etc/default/boothd* rm -f /instscript # Run fixperm to restore permissions of copied files fixperm /etc/perms/rts* >/dev/null 2>&1 [ -f /etc/perms/inst ] && { fixperm /etc/perms/inst >/dev/null 2>&1 } echo "\nRestoration complete.\n" return $OK } extract() { while : do echo "Extracting files ...\c" tar xvf /dev/rinstall > /dev/null 2>&1 && { [ "$instshell" ] || { # default: unixos sh, netos sh, odtps oash [ -f /tmp/perms/bundle/unixos -o -f /tmp/perms/bundle/netos ] && \ instshell=sh || instshell=oash } [ $instshell = oash ] || rm -f /bin/oash echo "" return $OK } rm -f /bin/oash echo "\nExtraction of master installation floppy failed.\nDo you want to try again? (y/n/q)" while : do read x case "$x" in 'y'|'Y') return $OK ;; 'n'|'N') return $FAIL ;; 'q'|'Q') [ -f /tmp/system_upgrade ] && { restore_old && return $STOP2 } return $FAIL ;; *) echo "Please enter y, n or q" esac done done } check () { while : do tar tqvf /dev/rinstall ./tmp/perms/bundle > /dev/null 2>&1 || { echo "\nIncorrect volume in drive." echo "\nInsert M1 (Master Installation) floppy\nand press or enter q to quit: \c" read x [ "$x" = "q" -o "$x" = "Q" ] && { [ -f /tmp/system_upgrade ] && restore_old && exit $STOP2 return $FAIL } continue } return $OK done } save () { [ -f /tmp/system_upgrade ] && { if [ -f /tmp/history.up ] then /bin/grep "$0" /tmp/history.up >/dev/null if [ $? != 0 ] then echo "\nSaving files for update ...\c" rm -fr /tmp/master.sav >/dev/null mkdir /tmp/master.sav cd / tar tf /dev/rinstall 2>/dev/null \ |cpio -pdum /tmp/master.sav >/dev/null 2>&1 [ -d /usr/lib/custom/fix ] && \ [ ! -d /usr/lib/custom/fix.sav ] && \ mv /usr/lib/custom/fix /usr/lib/custom/fix.sav echo "\n" cp /usr/lib/custom/history /usr/lib/custom/history.0 echo "$0" >>/tmp/history.up # log name in history fi fi } return $OK } # main cd / instshell= echo "\n\007Insert M1 (Master Installation) floppy\nand press or enter q to quit: \c" while : do rm -rf /tmp/perms read x case "$x" in 'q'|'Q') [ -f /tmp/system_upgrade ] && restore_old && exit $STOP2 exit $FAIL ;; "") check && save && extract && exit $OK exit $? ;; oash|sh) instshell=$x check && save && extract && exit $OK exit $? ;; *) echo "Press or enter q :\c" ;; esac done : # @(#) extractbtld 23.4 91/12/12 # # Copyright (C) 1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # extractbtld # # The first stage of btld: # prompts user to insert the relevant BTLD disk for each # package and copies the entire filesystem into /tmp/btld/N # where N is a sequential number starting from 1 # Thus, /tmp/btld/1 - holds contents of the first BTLD disk inserted # /tmp/btld/2 - second BTLD disk etc ... # # set the standard exit values : ${OK=0} ${FAIL=1} ${STOP=10} # set the environment variables LANG=english_us.ascii export LANG PATH=/etc:/bin:/usr/bin export PATH BTLDN=1 # Don't allow Del'ing out during this phase trap '' 1 2 3 15 create_nodes() { cd /tmp/btld/$1 for pkg in `cat /dev/string/pkg` do [ -d $pkg ] || continue for xnamex in `cat $pkg/install/btld` do xnamex=`basename $xnamex` Node=$pkg/driver/$xnamex/Node [ -s $Node ] || continue # call uadmin wiht 130 (A_GETDEV) to find out major bmajor=`/etc/uadmin 130 b $xnamex 2>/dev/null` cmajor=`/etc/uadmin 130 c $xnamex 2>/dev/null` while read intnam special type minor owner group mode do [ "X$intnam" = "X$xnamex" ] || continue devpath=`dirname /dev/$special` cd /dev [ -d $devpath ] || mkdir -m 755 -p $devpath eval major=\$${type}major mknod $special $type $major $minor [ -n "$mode" ] && chmod $mode $devpath echo $devpath >>/tmp/btld/Devices.Made done < $Node done done } # This temp file will hold the names of packages already extracted tmp=/tmp/btld.$$ rm -f $tmp plist="" plist=`cat /dev/string/pkg 2>/dev/null` [ -z "$plist" ] && exit $OK rm -fr /tmp/btld mkdir /tmp/btld echo "\nThe BTLD packages will now be extracted.\n" for p in $plist do # check if the package is already 'dealt with' grep $p $tmp >/dev/null 2>&1 || { while : do echo "\nPlease insert the $p volume and press : \c" read xx mount -r /dev/install /mnt >/dev/null 2>&1 if [ $? != 0 ] then echo "\nSorry, that volume does not contain the $p package" elif [ -f /mnt/$p/install/btld ] then break else umount /mnt >/dev/null 2>&1 echo "\nSorry, that volume does not contain the $p package" fi done # Extract the entire contents of filesystem echo "Extracting BTLD packages ...\c" mkdir /tmp/btld/$BTLDN cd /mnt find . -depth -print | cpio -pdlm /tmp/btld/$BTLDN 2>/dev/null # make the BTLD nodes create_nodes $BTLDN # mark the packages as 'dealt with' # assume all root dirs on BTLD filesystem are packages # Note cannot use ls because its not available at this point cd /tmp/btld/$BTLDN rm -f /tmp/btld/dlist echo * >/tmp/btld/dlist for f in `cat /tmp/btld/dlist` do if [ -d $f ] then echo "$f" >>$tmp fi done rm -f /tmp/btld/dlist umount /mnt >/dev/null 2>&1 # get ready for next BTLD disk BTLDN=`expr $BTLDN + 1` echo "\n" } done rm -f $tmp exit $OK k...lgetinstpathmkeyboard: # @(#) getinstpath 23.14 91/11/29 # # Copyright (C) 1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # getinstpath # # first script to get executed during installation # Deals with different install paths available # : ${OK=0} ${FAIL=1} ${STOP=10} ${STOP2=20} # set up the environment PATH=/bin:/usr/bin:/etc export PATH MES1="\n You are updating your Operating System from 3.2v4 to 3.2v4. This is not supported and may leave your system in an inconsistent state. \nDo you wish to continue ? (y/n) " ERR1="\n \tCannot perform an update, only release 3.2v2 systems\n \tcan be updated. Installation aborting ..." ERR2="\n \tCannot perform an update; problems with the root\n \tfilesystem on the hard disk. Installation aborting ..." # Clean up cleanup() { cd / if [ -f /tmp/system_upgrade ] then umount /dev/hd0root 2> /dev/null fi exit $1 } do_verify() { if [ -f /mnt/etc/perms/mpx ] then # The current system has MPX installed append="with SCO MPX.\n\nWarning: SCO MPX will have to be re-installed after the update.\n" else append="\b.\n" fi if [ -f /mnt/etc/perms/bundle/odtps ] then # The current system is ODT echo "\nYour current system is SCO Open Desktop \c" echo $append dist="SCO Open Desktop" else # The current system is UNIX echo "\nYour current system is SCO UNIX System V/386 \c" echo $append dist="SCO UNIX System V/386" fi while echo "Verify that your new product is $dist and enter 'c' to continue or 'q' to quit (c/q): \c" do read reply case "$reply" in 'c'|'C') return 0 ;; 'q'|'Q') return 1 ;; *) echo "\n" ;; esac done } # set a trap here so if the user dels out, we can unmount the hd0root trap 'cleanup $STOP' 1 2 3 15 cd / answer="" while [ "$answer" -lt "1" -o "$answer" -gt "3" ] do echo " SCO System Software Installation The Fresh installation option cleanly installs the new release of the software on your system.\n Installation selection: 1. Fresh installation 2. Exit Use the Numeric Keypad if present, using if necessary, to select one of the above options: \c" read answer case "$answer" in 1) # normal installation rm -f /tmp/system_upgrade # clear upgrade flag in ram disk break ;; # 2) # System update # # mount the hard disk root # /etc/mount /dev/hd0root /mnt > /dev/null 2>&1 || { # echo "Cannot mount the hard disk root filesystem. # The installation cannot proceed until this is possible. # Contact your Support Representative immediately. # Exiting..." # cleanup $FAIL # } # # # Check if this script already done # # if [ -f /mnt/tmp/history.up ] # then # /mnt/bin/grep "$0" /mnt/tmp/history.up >/dev/null # if [ $? = 0 ] # then # # recreate ram disk flag and cleanup # /mnt/bin/cp /mnt/tmp/system_upgrade /tmp/system_upgrade # cleanup $OK # this script already done successfully # fi # fi # # check that current system is a 3.2v2 # /mnt/bin/grep '3.2.[234]' /mnt/etc/perms/rts >/dev/null # if [ $? = 0 ] # then # # # Check if not v2 to v4 update # /mnt/bin/grep '3.2.2' /mnt/etc/perms/rts >/dev/null # [ $? = 0 ] || { # while # echo "$MES1 \c" # do # read reply # case "$reply" in # 'y'|'Y') # break # ;; # # 'n'|'N') # cleanup $STOP2 # ;; # *) # echo "\n" # ;; # esac # done # } # # Verify distribution # do_verify || { # cleanup $STOP2 # } # # invoke fsck to ensure current filesystem is OK # umount /dev/hd0root > /dev/null 2>&1 # echo "\nChecking current root filesystem ...\c" # /etc/fsck - /dev/hd0root >/dev/null 2>&1 # if [ $? = 0 ] # then # /etc/mount /dev/hd0root /mnt > /dev/null 2>&1 # /mnt/bin/grep '3.2.2' /mnt/etc/perms/rts >/dev/null # if [ $? = 0 ] # then # echo "v2" >/mnt/tmp/system_upgrade # echo "v2" >/tmp/system_upgrade # in ram disk # else # echo "v4" >/mnt/tmp/system_upgrade # echo "v4" >/tmp/system_upgrade # in ram disk # fi # # echo "\n" # echo "$0" >>/mnt/tmp/history.up # log name in history # else # echo $ERR2 # cleanup $FAIL # fi # else # echo $ERR1 # cleanup $STOP2 # fi # break # ;; 2) # user wants to quit cleanup $STOP ;; shell) # shell escape echo "Shell escape. System will halt when this shell exits." trap 1 2 3 15 PATH=/bin:/etc:/usr/bin:/mnt/bin:/mnt/etc:/mnt/usr/bin export PATH PS1=" "; export PS1 HOME=/; export HOME sh -i sync; sync; haltsys ;; *) # garbage input # cycle round the menu ;; esac done cleanup $OK : # @(#) keyboard 23.8 91/10/18 # # Copyright (C) 1988-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # keyboard - set up the installation keyboard keyboard environment # # standard exit values : ${OK=0} ${FAIL=1} ${STOP=10} # setup the environment variables LANG=english_us.ascii export LANG PATH=/etc:/bin:/usr/bin export PATH umask 0 cd / # set a trap so if the user dels out we exit with a STOP value # and the calling program can break out of the calling loop trap "exit $STOP" 1 2 3 15 # For system upgrade just exit if [ -f /tmp/system_upgrade ] then # mount the hard disk root and then perform mapkey /etc/mount /dev/hd0root /mnt > /dev/null 2>&1 || { echo "Cannot mount the hard disk root filesystem. The installation cannot proceed until this is possible. Contact your Support Representative immediately. Exiting..." exit $FAIL } [ -f /mnt/etc/default/boot -a -f /mnt/usr/lib/keyboard/keys ] && { /mnt/bin/grep "MAPKEY=Y" /mnt/etc/default/boot >/dev/null 2>&1 if [ $? -eq 0 ] then mapkey /mnt/usr/lib/keyboard/keys 2> /dev/null fi } /etc/umount /mnt >/dev/null 2>&1 exit $OK fi kbd="" while [ "$kbd" -lt "1" -o "$kbd" -gt "6" ] do echo " Keyboard Selection 1. American 2. British 3. French 4. German 5. Italian 6. Spanish Use the Numeric Keypad if present, using if necessary, to select one of the above options: \c" read kbd [ "$kbd" = "shell" ] && break done case $kbd in 1) ;; 2) mapkey /usr/lib/keyboard/ukd.ibm 2> /dev/null ;; 3) mapkey /usr/lib/keyboard/fra.ibm 2> /dev/null ;; 4) mapkey /usr/lib/keyboard/ger.ibm 2> /dev/null ;; 5) mapkey /usr/lib/keyboard/ita.ibm 2> /dev/null ;; 6) mapkey /usr/lib/keyboard/spa.ibm 2> /dev/null ;; shell) echo "Shell escape. System will halt when this shell exits." trap 1 2 3 15 PATH=/bin:/etc:/usr/bin:/mnt/bin:/mnt/etc:/mnt/usr/bin export PATH PS1=" "; export PS1 HOME=/; export HOME sh -i sync; sync; haltsys ;; esac # unset the trap trap "" 1 2 3 15 # exit OK so the calling program can move ahead in the installation exit $OK n...ohdinitprootfilesqtapestring: # @(#) hdinit 23.5 91/10/18 # # Copyright (C) 1988-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # hdinit - front end which will call /usr/lib/mkdev/hd # : ${OK=0} ${FAIL=1} ${STOP=10} # set up the environment PATH=/bin:/usr/bin:/etc export PATH cd / # set a trap so /instscript knows if the user dels out trap 'exit $STOP' 1 2 3 15 # For system upgrade just exit if [ -f /tmp/system_upgrade ] then exit $OK fi while : do echo " System V Hard Disk Initialization The primary hard disk in the system will now be initialized. This initialization process can be either fully configurable or automatic. The fully configurable initialization requires you to set the disk parameters, specify the size of the UNIX partition, and control the layout of the filesystems and swap area. System default values are available at each selection. The automatic disk initialization creates a complete disk layout and configuration using system default values. Initialization Selection: 1. Fully Configurable Initialization 2. Automatic Initialization (use system defaults) 3. Exit Installation Enter your choice: \c" read answer case $answer in 1) # unset the flags flags= break ;; 2) while : do # make sure the user understands what they are doing echo " Verify Automatic Disk Initialization You have chosen to initialize the primary hard disk automatically using system defaults. The hard disk initialization will preserve any pre-existing DOS partition, but will overwrite any non-DOS partitions. A single, active UNIX partition will be created and divided into a root filesystem, a swap area, and if the UNIX partition is 245 megabytes or larger, a user (/u) filesystem. Setting up the hard disk may take as long a one minute per megabyte of space on the disk. Are you sure you wish to do this (y or n): \c" read noninteryn case $noninteryn in Y|y) # okay, set the -n flag flags="-n" break 2 ;; N|n) # go back to main menu flags= break ;; *) # garbage input echo " Please answer 'y' or 'n'. Press to continue: \c" read answer ;; esac done ;; 3) # user wants to quit exit $STOP ;; *) # garbage input echo " Unknown answer: $answer Press to continue: \c" read answer ;; esac done # call mkdev hd exec /usr/lib/mkdev/hd 0 0 $flags : # @(#) rootfiles 23.11 91/11/25 # # Copyright (C) 1988-1991 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # rootfiles # # copies files from the floppy root and does some setup # for update: # - retain files listed in rootlist_up # - move perms files to a save dir /tmp/perms.sav # - save /dev to /tmp/dev.sav and then remove /dev to allow # for new nodes to generated from cpio of rootlist # - save files listed in rootlist in /tmp/root.sav to be used # if reverting back to old system. # : ${OK=0} ${FAIL=1} ${STOP=10} PATH=/bin:/etc:/usr/bin LANG=english_us.ascii export PATH LANG # Print an error message # # Usage: error "message" # Argument is a quoted error message # Notes: error always returns 1. # error() { echo "\nError: $*" >&2 return $FAIL } # Clean up cleanup() { cd / umount /dev/hd0root 2>&1 >/dev/null exit $1 } remove_nodes() { rm -fr /mnt/tmp/dev.sav mkdir /mnt/tmp/dev.sav cd /mnt/dev /mnt/bin/find ./ -print |cpio -pdum /mnt/tmp/dev.sav \ >/dev/null 2>&1 rm -fr /mnt/dev } # set a trap here so if the user dels out, we can unmount the hd0root trap 'cleanup $STOP' 1 2 3 15 # copy out the partition boot programs dd if=/etc/hdboot0 of=/dev/hd0a 2> /dev/null dd if=/etc/hdboot1 of=/dev/hd0a bs=1k seek=1 2> /dev/null # mount the hard disk root /etc/mount /dev/hd0root /mnt > /dev/null 2>&1 || { error "Cannot mount the hard disk root filesystem. The installation cannot proceed until this is possible. Contact your Support Representative immediately. Exiting..." cleanup $FAIL } if [ -f /mnt/tmp/system_upgrade ] then if [ -f /mnt/tmp/history.up ] then /mnt/bin/grep "$0" /mnt/tmp/history.up >/dev/null if [ $? != 0 ] then echo "Saving files for update ...\c" # save files to retain in /mnt/tmp/rootup.sav dir rm -fr /mnt/tmp/rootup.sav 2>&1 >/dev/null /bin/mkdir /mnt/tmp/rootup.sav > /dev/null 2>&1 cd /mnt # cpio input paths are from /dev/hd0root cpio -pdmu /mnt/tmp/rootup.sav < /rootlist_up > /dev/null 2>&1 /mnt/bin/cp /rootlist_up /mnt/rootlist_up >/dev/null 2>&1 # Move all perms files so custom does not complain # during installation rm -fr /mnt/tmp/perms.sav >/dev/null 2>&1 /bin/mkdir /mnt/tmp/perms.sav cd /mnt/etc/perms /mnt/bin/find ./ -print |cpio -pdmu /mnt/tmp/perms.sav >/dev/null 2>&1 cd / rm -fr /mnt/etc/perms # save /dev in tmp and remove it remove_nodes cd / # Save files listed in rootlist rm -fr /mnt/tmp/root.sav >/dev/null 2>&1 /bin/mkdir /mnt/tmp/root.sav cd /mnt cpio -pdmu /mnt/tmp/root.sav /dev/null 2>&1 [ -f /mnt/bin/oash ] && /mnt/bin/mv /mnt/bin/oash /mnt/tmp/root.sav/bin/oash # retain /dev/swap and /dev/rswap for update, for fresh these # are created by divvy. cd /mnt/tmp/dev.sav echo swap | cpio -p /mnt/dev >/dev/null 2>&1 echo rswap | cpio -p /mnt/dev >/dev/null 2>&1 echo "$0" >>/mnt/tmp/history.up # log name of script in history fi fi else echo "\nSetting up hard disk root filesystem ...\c" fi # copy files listed in rootlist for normal installation echo "\nExtracting files ...\c" cd / cpio -pdmu /mnt < /rootlist > /dev/null 2>&1 # retain /usr/lib/keyboard/keys file if update [ -f /tmp/system_upgrade ] || { # set the keyboard nationality on hard disk root mapkey -d > /mnt/usr/lib/keyboard/keys 2> /dev/null } # copy over any file and directory in /hdisk if it is there [ -d "/hdisk" ] && { cd /hdisk for x in `echo *`; do echo $x; done | cpio -pdmu /mnt 2> /dev/null for x in `echo */*`; do echo $x; done | cpio -pdmu /mnt 2> /dev/null cd / } echo "\n" umount /mnt >/dev/null 2>&1 #mounted by this script exit $OK : # @(#) tapestring 25.2.1.1 92/10/16 # # Copyright (C) 1990-1992 The Santa Cruz Operation, Inc. # All Rights Reserved. # The information in this file is provided for the exclusive use of # the licensees of The Santa Cruz Operation, Inc. Such users have the # right to use, modify, and incorporate this code into other products # for purposes authorized by the license agreement provided they include # this notice and the associated copyright notice with any such product. # The information in this file is provided "AS IS" without warranty. # # tapestring: reads information from user on type of tape # device to put in /etc/default/boothd1 for tape install. # PATH=:/bin:/usr/bin:/etc # # Status return codes : ${OK=0} ${FAIL=1} ${STOP=10} ${HALT=11} ${STOP2=20} # Directory where boot files are located. DEFDIR=/mnt/etc/default # Filenames BOOTHD=$DEFDIR/boothd1 BOOTFN=/mnt/tmp/config_boot OFILE=$DEFDIR/out # Where to read configuration info HWCONFIG=/dev/string/cfg HWDEFVALS= DEFVALS="\ - - - scsi 0x130 5 7 compaq 0x338 5 1 wangtek 0x2c0 5 1 everex 0x220 3 3 archive 0x28c 3 1 mountain 0x300 9 3 emerald 0x2c0 5 1 tandberg 0x330 5 1 tecmar 0x330 5 1 btld" MCDEFVALS="\ - - - scsi 0x300 5 3 wangtek 0x300 3 1 everex 0x300 3 1 archive 0x300 3 1 tandberg 0x200 5 1 mountain 0x3120 6 2 ibm6157 0x300 5 3 tecmar 0x330 5 1 btld" # Here are the keywords that will be added to the DEFBOOTSTR TAPEKEY=ct APPENDAGE= # # Variables to hold the actual values used. TAPENAME= BASE= IRQ= DMA= # Strings for 'yes', 'no', and 'quit' replies. QSTR1=q QSTR2=Q YESSTR1=y YESSTR2=Y NOSTR1=n NOSTR2=N # Strings for prompts, etc. PSTR1='Enter the Base Address of the tape controller (in hex: 0xNNNN):' PSTR2='Enter the Interrupt Level of this controller (decimal integer):' PSTR3='Enter the DMA Channel of the tape controller (decimal integer):' PSTR4='Bad value: Base Address must be a hex value (e.g. 0x1234).' PSTR5='Bad value: Interrupt Level must be a decimal integer, 1 to 15.' PSTR6='Bad value: DMA Channel must be a decimal integer, 0 to 7.' PSTR7='Enter the Compaq SCSI Target ID of the tape controller (decimal integer):' PSTR8='Bad value: SCSI Target ID must be a decimal integer, 0 to 7.' MSTR0='\nThe following tape drives are supported:\n' PSTR0='Enter your choice or q to quit ' ESTR1='Cannot mount the hard disk root filesystem.' ESTR2='The installation cannot proceed until this is possible.' ESTR3='Contact your Support Representative immediately.' ESTR4='Exiting...' ESTR5='\nYou must have your SCSI tape drive configured as:' ESTR6='\tSCSI Target ID:\t\t2' ESTR7='\tSCSI Host Adapter:\t0' ESTR8='\tLogical Unit Number:\t0' ESTR9='\nYou must have your CD-ROM drive configured as:' ESTR10='\tSCSI Target ID:\t\t5' CONFSTR1='\nDo you wish to use these values? (y/n/q) \c' CONFSTR2='\nConfirm that your drive is configured to these values? (y/n/q) \c' BASESTR='\tBase Address:\t' IRQSTR='\tInterrupt Level:' DMASTR='\tDMA Channel:\t' DEFSTR1='\nHere are the default values for' CURSTR1='\nHere are the values entered for' # Clean up cleanup() { trap '' 1 2 3 15 cd / /etc/umount /dev/hd0root 2> /dev/null exit $1 } restore_old() { echo "\nRestoring previous system ...\c" rm -fr /mnt/tmp/sdev.up # Restore device nodes cd /mnt/dev rm -fr ./* cd /mnt/tmp/dev.sav /mnt/bin/find ./ -print |cpio -pdum /mnt/dev >/dev/null 2>&1 # Restore the N02 (rootlist) files cd /mnt/tmp/root.sav /mnt/bin/find ./ -print |cpio -pdum /mnt >/dev/null 2>&1 # Restore perms files mkdir /mnt/etc/perms cd /mnt/tmp/perms.sav /mnt/bin/find ./ -print |cpio -pdum /mnt/etc/perms >/dev/null 2>&1 # Tidy up cd /mnt rm -fr /mnt/inst? 2>/dev/null rm -fr /mnt/hdisk 2>/dev/null rm -fr /mnt/tmp/fs.up >/dev/null rm -fr /mnt/tmp/dev.sav >/dev/null rm -fr /mnt/tmp/root.sav >/dev/null rm -fr /mnt/tmp/rootup.sav >/dev/null rm -fr /mnt/tmp/upgrade.sav >/dev/null rm -fr /mnt/tmp/perms.sav rm -fr /mnt/tmp/perms >/dev/null rm -f /mnt/tmp/system_upgrade rm -f /mnt/tmp/fs.xx rm -f /mnt/tmp/termtype rm -f /mnt/tmp/config_boot rm -f /mnt/rootlist_up rm -f /mnt/rootlist rm -f /mnt/tmp/history.up rm -f /mnt/etc/default/boothd* rm -f /mnt/instscript # Run fixperm to restore permissions of copied files cd /mnt /mnt/etc/fixperm /mnt/etc/perms/rts* >/dev/null 2>&1 [ -f /mnt/etc/perms/inst ] && { /mnt/etc/fixperm /mnt/etc/perms/inst >/dev/null 2>&1 } echo "\nRestoration complete.\n" cleanup $STOP2 } get_tape() { # Emit first prompt echo "$MSTR0" echo "$DEFVALS" | sed "s/...........//" set -- "" set -- $HWDEFVALS echo "\n$PSTR0"\[$4\]": \c" # While not EOF ... while read TAPENAME do [ "$TAPENAME" ] || TAPENAME=$4 # for default case "$TAPENAME" in "") # Reject if no default ;; ${QSTR1}|${QSTR2}) # Quit. return $STOP ;; "btld"|"BTLD") # just exit if btld cleanup $OK ;; *) set -- "" set -- `echo "$HWDEFVALS \n$DEFVALS" | sed -n "\% $TAPENAME%p"` TAPENAME=$4 BASE=$1 IRQ=$2 DMA=$3 [ "$TAPENAME" = "scsi" ] && { echo "$ESTR5\n" return $OK } [ "$TAPENAME" ] && { echo "$DEFSTR1 $TAPENAME:\n" return $OK } ;; # Reprompt if no match esac # Emit 2nd et seq. prompts. set -- "" set -- $HWDEFVALS echo "\n$PSTR0"\[$4\]": \c" done return $FAIL # read returned EOF. } get_base() { # Emit first prompt echo "\n$PSTR1 $BASE \c" SAVBASE=$BASE # While not EOF ... while read BASE do [ "$BASE" ] || BASE=$SAVBASE # for default case "$BASE" in 0x[0-9a-fA-F][0-9a-fA-F][0-9a-fA-F][0-9a-fA-F]|\ 0x[0-9a-fA-F][0-9a-fA-F][0-9a-fA-F]) return $OK ;; [0-9a-fA-F][0-9a-fA-F][0-9a-fA-F][0-9a-fA-F]|\ [0-9a-fA-F][0-9a-fA-F][0-9a-fA-F]) BASE="0x$BASE" return $OK ;; ${QSTR1}*|${QSTR2}*) # Quit: return to menu return $FAIL ;; *) echo "$PSTR4" # 'Bad value' error message ;; esac # Emit 2nd et seq. prompts. BASE=$SAVBASE echo "$PSTR1 $BASE \c" done return $FAIL # read returned EOF. } get_intr() { # Emit first prompt echo "$PSTR2 $IRQ \c" SAVIRQ=$IRQ # While not EOF ... while read IRQ do [ "$IRQ" ] || IRQ=$SAVIRQ # for default case "$IRQ" in 2|2[4-9]|3[0-1]) [ $IRQ -eq 2 ] && UNIXIRQ=9 || UNIXIRQ=`expr $IRQ - 16` echo "Using the UNIX equivalent $UNIXIRQ instead of $IRQ" IRQ=$UNIXIRQ return $OK ;; [1-9]|1[0-5]) return $OK ;; ${QSTR1}*|${QSTR2}*) # Quit: return to menu return $FAIL ;; *) echo "$PSTR5" # 'Bad value' error message ;; esac # Emit 2nd et seq. prompts. IRQ=$SAVIRQ echo "$PSTR2 $IRQ \c" done return $FAIL # read returned EOF. } get_dma() { # Emit first prompt echo "$PSTR3 $DMA \c" SAVDMA=$DMA # While not EOF ... while read DMA do [ "$DMA" ] || DMA=$SAVDMA # for default case "$DMA" in [0-7]) return $OK ;; ${QSTR1}*|${QSTR2}*) # Quit: return to menu return $FAIL ;; *) echo "$PSTR6" # 'Bad value' error message ;; esac # Emit 2nd et seq. prompts. DMA=$SAVDMA echo "$PSTR3 $DMA \c" done return $FAIL # read returned EOF. } get_cpqsid() { # Emit first prompt: no default known in this case echo "\n$PSTR7 \c" # While not EOF ... while read CID do case "$CID" in [0-7]) return $OK ;; ${QSTR1}*|${QSTR2}*) # Quit: return to menu return $FAIL ;; *) echo "$PSTR8" # 'Bad value' error message ;; esac # Emit 2nd et seq. prompts. echo "$PSTR7 \c" done return $FAIL # read returned EOF. } scsi_mknod() { rm -f /mnt/dev/*ct* # Make the *ct* devices with Stp or cpqs device major/minor /etc/mknod /mnt/dev/rct0 c $1 $2 /etc/mknod /mnt/dev/nrct0 c $1 $3 /etc/mknod /mnt/dev/xct0 c $1 $4 /bin/chmod 666 /mnt/dev/rct0 /mnt/dev/nrct0 /mnt/dev/xct0 return $OK } cdrom_mknod() { rm -f /mnt/dev/*cdt* /etc/mknod /mnt/dev/rcdt0 c $1 $2 /etc/mknod /mnt/dev/nrcdt0 c $1 $3 /etc/mknod /mnt/dev/xcdt0 c $1 $4 /bin/chmod 444 /mnt/dev/rcdt0 /mnt/dev/nrcdt0 /mnt/dev/xcdt0 return $OK } confirm_values() { while : do if [ "$TAPENAME" = "scsi" ] then echo "$ESTR6" echo "$ESTR7" echo "$ESTR8" echo "$CONFSTR2" elif [ "$TAPENAME" = "cdrom" ] then echo "$ESTR9\n" echo "$ESTR10" echo "$ESTR7" echo "$ESTR8" echo "$CONFSTR2" else echo "$BASESTR $BASE" echo "$IRQSTR $IRQ" echo "$DMASTR $DMA" echo "$CONFSTR1" fi read REPLY case "$REPLY" in ${YESSTR1}*|${YESSTR2}*) return $OK ;; ${NOSTR1}*|${NOSTR2}*) # Edit values return $FAIL ;; ${QSTR1}*|${QSTR2}*) # Return to menu return $STOP ;; *) continue ;; esac done } write_file() { case "$TAPENAME" in scsi) scsi_mknod 46 0 12 128 return $OK # no bootstring ;; cdrom) cdrom_mknod 50 0 8 128 return $OK # no bootstring ;; compaq) get_cpqsid || return $FAIL MID=`expr $CID \* 32` scsi_mknod 65 $MID `expr 1 + $MID` `expr 224 + $CID` ;; tandberg) TAPENAME=everex ;; esac HWDEF=`echo "$HWDEFVALS" | sed -n "\%$BASE.$IRQ.$DMA.$TAPENAME%p"` [ "$HWDEF" ] && return $OK : >$OFILE APPENDAGE="$TAPEKEY=$TAPENAME($BASE,$IRQ,$DMA)" while read BOOTSTRING do case "$BOOTSTRING" in DEFBOOTSTR=*) echo "$BOOTSTRING $APPENDAGE" >>$OFILE ;; *) echo "$BOOTSTRING" >>$OFILE ;; esac done <$BOOTHD cat $OFILE >$BOOTHD rm $OFILE # leave the boot appendage in a file that rtsinstall can find. echo $APPENDAGE > $BOOTFN return $OK } try_mount() { # mount the hard disk root /etc/mount /dev/hd0root /mnt > /dev/null 2>&1 || { # ESTR1 through 4 are one long message. echo $ESTR1 echo $ESTR2 echo $ESTR3 echo $ESTR4 cleanup $FAIL } } set_defvals() { HWDEFVALS=`sed -n -e "/%tape /p" < $HWCONFIG | \ sed -e "s/%tape //" -e "s/ / /g" \ -e "s/ / /g" -e "s/-[0-9A-Fx]*//" -e "s/^ /- /" \ -e "s/type=S/type=scsi/" -e "s/ type=/ /"` # determine which architecture we are running on # note: on MCA the POS autodetection is reliable, # but give the user the same interface as ISA; # split "NOPQtecmar/wangtek" into separate lines if cat /dev/mcapos 1>/dev/null 2>/dev/null then DEFVALS="$MCDEFVALS" WANGTEK=`echo "$HWDEFVALS" | sed -n "s%tecmar/%%p"` [ "$WANGTEK" ] && { HWDEFVALS=`echo "$HWDEFVALS" | sed "s%/wangtek%%"` HWDEFVALS="$HWDEFVALS \n$WANGTEK" } ARCHIVE=`echo "$HWDEFVALS" | sed -n "s%everex/%%p"` [ "$ARCHIVE" ] && { HWDEFVALS=`echo "$HWDEFVALS" | sed "s%/archive%%"` HWDEFVALS="$HWDEFVALS \n$ARCHIVE" } TANDBERG=`echo "$HWDEFVALS" | sed -n "s%everex%tandberg%p"` [ "$TANDBERG" ] && HWDEFVALS="$HWDEFVALS \n$TANDBERG" else # on AT, allow tandberg for everex TANDBERG=`echo "$HWDEFVALS" | sed -n "s%everex%tandberg%p"` [ "$TANDBERG" ] && HWDEFVALS="$HWDEFVALS \n$TANDBERG" fi } do_tape() { set_defvals while : do get_tape [ $? = $STOP ] && return $STOP confirm_values case $? in $OK) write_file && return $OK ;; $STOP) if [ "$TAPENAME" = "scsi" ] then return $STOP fi ;; # loop around menu for normal tape $FAIL) if [ "$TAPENAME" = "scsi" ] then write_file && return $FAIL else get_base && get_intr && get_dma && { echo "$CURSTR1 $TAPENAME:\n" confirm_values && write_file && return $OK } fi ;; *) ;; esac done } do_cdrom() { while echo "\nAre you using BTLD for CD-ROM? (y/n/q): \c" do read REPLY case "$REPLY" in ${YESSTR1}*|${YESSTR2}*) # just exit for btld while echo "\nIs your CD-ROM drive configured for BTLD? (y/n): \c" do read rep2 case "$rep2" in ${YESSTR1}*|${YESSTR2}*) # just exit this script return $OK ;; ${NOSTR1}*|${NOSTR2}*) # user wants resume haltsys return $FAIL ;; *) continue ;; # loop round esac done ;; ${NOSTR1}*|${NOSTR2}*) # exit the loop break ;; ${QSTR1}*|${QSTR2}*) # Return to menu return $STOP ;; *) continue ;; # loop round esac done TAPENAME="cdrom" while : do confirm_values case $? in $OK) write_file && return $OK ;; $STOP) return $STOP ;; $FAIL) return $FAIL ;; *) ;; esac done } # main program starts here. # set a trap here so if the user dels out, we can unmount the hd0root trap 'cleanup $STOP' 1 2 3 15 try_mount while : do rm -f /mnt/tmp/mediatype $BOOTFN answer="" while [ "$answer" -lt "1" -o "$answer" -gt "3" ] do echo " Product Medium Selection SCO systems software provides three media for installing the product. At this point, you can select the installation medium and configure the driver parameters for the installation device. Medium Selection: 1. Floppy Diskette 2. Cartridge Tape 3. Compact Disc (CD-ROM) Enter your choice or q to quit: \c" read answer [ "$answer" = $QSTR1 -o "$answer" = $QSTR2 ] && break done case "$answer" in "1") # floppy echo F >/mnt/tmp/mediatype cleanup $OK ;; "2") # Tape echo T >/mnt/tmp/mediatype do_tape case $? in $OK) cleanup $OK ;; $FAIL) cleanup $STOP ;; # output resume haltsys *) ;; # loop round the menu again esac ;; "3") # CD-ROM echo C >/mnt/tmp/mediatype do_cdrom case $? in $OK) cleanup $OK ;; $FAIL) cleanup $STOP ;; # output resume haltsys *) ;; # loop round the menu again esac ;; ${QSTR1}|${QSTR2}) # quit installation if [ -f /mnt/tmp/system_upgrade ] then restore_old else cleanup $OK fi ;; *) ;; esac done L+  p@.textppp .data@@@.bss@@ .fka000C".fka040@@LB.fka041L@L@.comment".lib@X@@@@@ @"@$@\@(@@,@ @@ @@P@4@0@$@8@@ÐET@RU RPWh@jL@ PjUV}}h@jf th @jEM uu >uE p' }E pj_h8@p }h<@6j7E PE p=L@~"@9L@L@4@hX@ 5L@hd@j^UV@=L@|@9L@} L@4@}tE8tPh@h|@ 5L@V@u @@Ph|@^Ð=ÐÐÐ5@t$ t$  Ð;T$ÐUu1@u3Uu@u3ÐEÐU=@ uÐ@M @@3ÐUV5@Ny^Ð@Ny^Ðusage: chroot rootdir command arg ... chroot: not super-user /Can't chdir to new root chroot: %s chroot: exec failed, errno = %d %s: %s %d %s Error@ @@4@D@\@h@@@@@@@@ @ @0 @< @H @\ @l @| @ @ @ @ @ @ @ @ @$ @< @L @X @p @ @ @ @ @ @ @ @( @H @d @t @ @ @ @ @ @ @ @ @4 @H @X @p @ @ @ @ @ @ @ @ @( @< @T @d @t @ @ @ @ @ @ @ @ @ @@4@T@l@@@@@D@P@l@@@@@@@4@L@h@@@@@@$@<@`@@@@@@@(@@@T@d@x@@@@@@@@@@@@@ @,@8@D@P@l@x@@@@@@@@@@ @@$@0@Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageFilename too longError 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directlyError 88Function not implementedOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerError 109Socket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedHost is downNo route to hostProtocol not availableError 119Error 120Error 121Error 122Error 123Error 124Error 125Error 126Error 127Error 128Error 129Error 130Error 131Error 132Error 133Error 134Structure needs cleaningError 136Not a name fileNot availableIs a name fileRemote I/O errorError 141Error 142Error 143Error 144Directory not emptyError 146Error 147Error 148Error 149Too many symbolic links in path ((((( H "@"@@"@@(#)SCO UNIX 3.2v4.2 OS 93/03/16/shlib/libc_ss...tdskurdskvstringyrct0znrct0{erct0|xct0}rStp0}urStp0~nurStp0nrStp0xStp0rcdt0nrcdt0xcdt0prfecceisa0errormcaposinstallrinstallnullconsolesysconsysttyttytty01hd00hd01hd02hd03hd04hd0arhd00rhd01rhd02rhd03rhd04rhd0arootrrootropipeswaprswaprhd0roothd0rootbAFAbAFBbAFCbAFDbAFEbAFFbAFGbAFHcAFHt.s..u.s..0s00sav.s..bootpkgcfgw...x...1 ./usr/lib/keyboard/ita.ibm N02 RTS sf644 bin/bin 1 ./usr/lib/keyboard/spa.ibm N02 RTS sf644 bin/bin 1 ./usr/lib/keyboard/ukd.ibm N02 RTS sf644 bin/bin 2 ./usr/lib/keyboard/usa.ibm N02 ./usr/lib/keyboard/at.ibm.usa N02 # RTS sf700 bin/bin 1 ./usr/lib/mkdev/.hdfuncs N02 RTS sf700 bin/bin 1 ./usr/lib/mkdev/hd N02 # RTS f644 root/other 3 ./usr/lib/terminfo/a/ansi N02 ./usr/lib/terminfo/a/ansi80x25 N02 ./usr/lib/terminfo/a/ansic N02 RTS f644 root/other 2 ./usr/lib/terminfo/a/ansi_ncc N02 ./usr/lib/terminfo/a/ansi80x25_ncc N02 # # Device Special Files # RTS c440 audit/audit 1 ./dev/auditr 21/0 RTS c660 audit/audit 1 ./dev/auditw 21/1 RTS c644 sysinfo/sysinfo 1 ./dev/cmos 7/0 RTS c444 sysinfo/sysinfo 1 ./dev/mcapos 7/2 RTS c440 root/mem 1 ./dev/mem 4/0 RTS c440 root/mem 1 ./dev/kmem 4/1 RTS c666 root/sys 1 ./dev/null 4/2 RTS c666 bin/terminal 1 ./dev/tty 3/0 RTS c640 sysinfo/sysinfo 1 ./dev/rroot 1/40 RTS b440 root/backup 1 ./dev/root 1/40 RTS c600 sysinfo/sysinfo 1 ./dev/rswap 1/41 RTS b440 root/mem 1 ./dev/swap 1/41 RTS c444 sysinfo/sysinfo 1 ./dev/error 32/0 RTS b600 sysinfo/sysinfo 1 ./dev/ram00 31/0 # # Real time clock and devices for /etc/getclk # RTS c644 sysinfo/sysinfo 1 ./dev/clock 8/0 RTS c660 bin/bin 1 ./dev/rtc 8/0 # # Printer Devices. # Minor 0 is "Port 1" on the parallel adaptor card. # Minor 1 is "Port 2" on the parallel adaptor card. # Minor 2 is the parallel port on the monochrome console card. # RTS C600 bin/bin 2 ./dev/lp0 6/0 ./dev/lp RTS C600 bin/bin 1 ./dev/lp1 6/1 RTS C600 bin/bin 1 ./dev/lp2 6/2 # # Console Devices # RTS c622 bin/terminal 3 ./dev/console 3/1 ./dev/syscon ./dev/systty RTS c666 bin/bin 2 ./dev/monochrome 52/1 ./dev/mono RTS c666 bin/bin 3 ./dev/colour 52/2 ./dev/color ./dev/cga RTS c666 bin/bin 1 ./dev/ega 52/4 RTS c666 bin/bin 1 ./dev/vga 52/5 # # Multiscreens # RTS c666 bin/terminal 1 ./dev/tty01 0/0 RTS c666 bin/terminal 1 ./dev/tty02 0/1 RTS c666 bin/terminal 1 ./dev/tty03 0/2 RTS c666 bin/terminal 1 ./dev/tty04 0/3 RTS c666 bin/terminal 1 ./dev/tty05 0/4 RTS c666 bin/terminal 1 ./dev/tty06 0/5 RTS c666 bin/terminal 1 ./dev/tty07 0/6 RTS c666 bin/terminal 1 ./dev/tty08 0/7 RTS c666 bin/terminal 1 ./dev/tty09 0/8 RTS c666 bin/terminal 1 ./dev/tty10 0/9 RTS c666 bin/terminal 1 ./dev/tty11 0/10 RTS c666 bin/terminal 1 ./dev/tty12 0/11 # # Serial Lines Without Modem Control # RTS C666 bin/bin 1 ./dev/tty1a 5/0 RTS C666 bin/bin 1 ./dev/tty2a 5/8 # # Serial Lines With Modem Control # RTS C666 bin/bin 1 ./dev/tty1A 5/128 RTS C666 bin/bin 1 ./dev/tty2A 5/136 # # Low Density Floppy Disk Drives # RTS c666 bin/bin 2 ./dev/rfd048ss8 2/8 ./dev/rdsk/f0d8t RTS c666 bin/bin 3 ./dev/rfd048ds8 2/12 ./dev/rdsk/f0d8dt ./dev/rdsk/f05d8t RTS c666 bin/bin 2 ./dev/rfd048ss9 2/0 ./dev/rdsk/f0d9t RTS c666 bin/bin 4 ./dev/rfd048 2/4 ./dev/rfd048ds9 ./dev/rdsk/f0d9dt ./dev/rdsk/f05d9t RTS c666 bin/bin 2 ./dev/rfd148ss8 2/9 ./dev/rdsk/f1d8t RTS c666 bind~}|{zyxwvutsrqponmlkjihgfedcdefghTS b666 bin/bin 3 ./dev/fd148ds8 2/13 ./dev/dsk/f1d8dt ./dev/dsk/f15d8t RTS b666 bin/bin 2 ./dev/fd148ss9 2/1 ./dev/dsk/f1d9t RTS b666 bin/bin 5 ./dev/fd148 2/5 ./dev/fd148ds9 ./dev/dsk/f1d9dt ./dev/dsk/f15d9t ./dev/sctfdl1 RTS b666 bin/bin 2 ./dev/dsk/f0d8d 2/140 ./dev/dsk/f05d8 RTS b666 bin/bin 1 ./dev/dsk/f0d8 2/136 RTS b666 bin/bin 3 ./dev/dsk/f0d9d 2/132 ./dev/sctfdl128 ./dev/dsk/f05d9 RTS b666 bin/bin 1 ./dev/dsk/f0d9 2/128 RTS b666 bin/bin 2 ./dev/dsk/f1d8d 2/137 ./dev/dsk/f15d8 RTS b666 bin/bin 3 ./dev/dsk/f1d9d 2/133 ./dev/dsk/f15d9 ./dev/sctfdl129 RTS b666 bin/bin 1 ./dev/dsk/f1d9 2/129 # # High Density Floppy Disk Drives # RTS c666 bin/bin 3 ./dev/rdsk/f0 2/180 ./dev/rdsk/f0q15d ./dev/rdsk/f05h RTS c666 bin/bin 4 ./dev/rfd0135ds9 2/36 ./dev/rdsk/f03dt ./dev/rfd096ds9 ./dev/rdsk/f0q9dt RTS c666 bin/bin 1 ./dev/rdsk/f03d 2/164 RTS c666 bin/bin 5 ./dev/rfd096ds15 2/52 ./dev/rfd096 ./dev/rdsk/f0q15dt ./dev/rdsk/f05ht ./dev/rdsk/f0t RTS c666 bin/bin 5 ./dev/rfd0135ds18 2/60 ./dev/rfd0 ./dev/rdsk/f03ht ./dev/rfd096ds18 ./dev/rdsk/f0q18dt RTS c666 bin/bin 4 ./dev/rfd1135ds9 2/37 ./dev/rdsk/f13dt ./dev/rfd196ds9 ./dev/rdsk/f1q9dt RTS c666 bin/bin 2 ./dev/rdsk/f1q9d 2/165 ./dev/rdsk/f13d RTS c666 bin/bin 6 ./dev/rfd196ds15 2/53 ./dev/rfd196 ./dev/rdsk/f1q15dt ./dev/rdsk/f15ht ./dev/rdsk/f1t ./dev/rfd1 RTS c666 bin/bin 4 ./dev/rfd1135ds18 2/61 ./dev/rdsk/f13ht ./dev/rfd196ds18 ./dev/rdsk/f1q18dt RTS c666 bin/bin 2 ./dev/rdsk/f0q18d 2/188 ./dev/rdsk/f03h RTS c666 bin/bin 3 ./dev/rdsk/f1q15d 2/181 ./dev/rdsk/f15h ./dev/rdsk/f1 RTS c666 bin/bin 2 ./dev/rdsk/f1q18d 2/189 ./dev/rdsk/f13h # RTS b666 bin/bin 4 ./dev/dsk/f0 2/180 ./dev/dsk/f0q15d ./dev/dsk/f05h ./dev/sctfdm128 RTS b666 bin/bin 4 ./dev/fd0135ds9 2/36 ./dev/dsk/f03dt ./dev/fd096ds9 ./dev/dsk/f0q9dt RTS b666 bin/bin 1 ./dev/dsk/f03d 2/164 RTS b666 bin/bin 6 ./dev/fd096ds15 2/52 ./dev/fd096 ./dev/dsk/f0q15dt ./dev/dsk/f05ht ./dev/dsk/f0t ./dev/sctfdm0 RTS b666 bin/bin 5 ./dev/fd0135ds18 2/60 ./dev/fd0 ./dev/dsk/f03ht ./dev/fd096ds18 ./dev/dsk/f0q18dt RTS b666 bin/bin 4 ./dev/fd1135ds9 2/37 ./dev/dsk/f13dt ./dev/fd196ds9 ./dev/dsk/f1q9dt RTS b666 bin/bin 2 ./dev/dsk/f1q9d 2/165 ./dev/dsk/f13d RTS b666 bin/bin 7 ./dev/fd196ds15 2/53 ./dev/fd196 ./dev/dsk/f1q15dt ./dev/dsk/f15ht ./dev/fd1 ./dev/dsk/f1t ./dev/sctfdm1 RTS b666 bin/bin 4 ./dev/fd1135ds18 2/61 ./dev/dsk/f13ht ./dev/fd196ds18 ./dev/dsk/f1q18dt RTS b666 bin/bin 2 ./dev/dsk/f0q18d 2/188 ./dev/dsk/f03h RTS b666 bin/bin 4 ./dev/dsk/f1q15d 2/181 ./dev/dsk/f1 ./dev/dsk/f15h ./dev/sctfdm129 RTS b666 bin/bin 2 ./dev/dsk/f1q18d 2/189 ./dev/dsk/f13h # # /dev/(r)install(1) and /dev/(r)dsk/finstall(1): # the latter is like /dev/install but skips the first track # RTS b666 bin/bin 1 ./dev/install 2/64 RTS c666 bin/bin 1 ./dev/rinstall 2/64 RTS b666 bin/bin 1 ./dev/install1 2/65 RTS c666 bin/bin 1 ./dev/rinstall1 2/65 RTS b666 bin/bin 1 ./dev/dsk/finstall 2/192 RTS c666 bin/bin 1 ./dev/rdsk/finstall 2/192 RTS b666 bin/bin 1 ./dev/dsk/finstall1 2/193 RTS c666 bin/bin 1 ./dev/rdsk/finstall1 2/193 # # Hard Disk Drive 0 # RTS b600 sysinfo/sysinfo 2 ./dev/hd00 1/0 ./dev/dsk/0s0 RTS b600 sysinfo/sysinfo 2 ./dev/hd01 1/15 ./dev/dsk/0s1 RTS b600 sysinfo/sysinfo 2 ./dev/hd02 1/23 ./dev/dsk/0s2 RTS b600 sysinfo/sysinfo 2 ./dev/hd03 1/31 ./dev/dsk/0s3 RTS b600 sysinfo/sysinfo 2 ./dev/hd04 1/39 ./dev/dsk/0s4 RTS b600 sysinfo/sysinfo 2 ./dev/hd0a 1/47 ./dev/dsk/0sa RTS b640 dos/sysinfo 3 ./dev/hd0d 1/48 ./dev/dsk/0sd ./dev/dsk/0sC RTS b640 dos/sysinfo 1 ./dev/dsk/0sD 1/49 RTS b640 dos/sysinfo 1 ./dev/dsk/0sE 1/50 RTS b640 dos/sysinfo 1 ./dev/dsk/0sF 1/51 RTS b640 dos/sysinfo 1 ./dev/dsk/0sG 1/52 RTS b640 dos/sysinfo 1 ./dev/dsk/0sH 1/53 RTS b640 dos/sysinfo 1 ./dev/dsk/0sI 1/54 RTS b640 dos/sysinfo 1 ./dev/dsk/0sJ 1/55 # RTS c600 sysinfo/sysinfo 2 ./dev/rhd00 1/0 ./dev/rdsk/0s0 RTS c600 sysinfo/sysinfo 2 ./dev/rhd01 1/15 ./dev/rdsk/0s1 RTS c600 sysinfo/sysinfo 2 ./dev/rhd02 1/23 ./dev/rdsk/0s2 RTS c600 sysinfo/sysinfo 2 ./dev/rhd03 1/31 ./dev/rdsk/0s3 RTS c600 sysinfo/sysinfo 2 ./dev/rhd04 1/39 ./dev/rdsk/0s4 RTS c600 sysinfo/sysinfo 2 ./dev/rhd0a 1/47 ./dev/rdsk/0sa RTS c640 dos/sysinfo 3 ./dev/rhd0d 1/48 ./dev/rdsk/0sd ./dev/rdsk/0sC RTS c640 dos/sysinfo 1 ./dev/rdsk/0sD 1/49 RTS c640 dos/sysinfo 1 ./dev/rdsk/0sE 1/50 RTS c640 dos/sysinfo 1 ./dev/rdsk/0sF 1/51 RTS c640 dos/sysinfo 1 ./dev/rdsk/0sG 1/52 RTS c640 dos/sysinfo 1 ./dev/rdsk/0sH 1/53 RTS c640 dos/sysinfo 1 ./dev/rdsk/0sI 1/54 RTS c640 dos/sysinfo 1 ./dev/rdsk/0sJ 1/55 ./boot ./unix ./sfmt ./bin/clear ./bin/cp ./bin/ln ./bin/mv ./etc/mvdir ./bin/false ./bin/iAPX286 ./bin/vax ./bin/i286 ./bin/mc68k ./bin/pdp11 ./bin/u370 ./bin/u3b ./bin/u3b15 ./bin/u3b2 ./bin/u3b5 ./bin/find ./bin/grep ./bin/ls ./bin/lc ./bin/lr ./bin/lx ./bin/lf ./bin/l ./bin/pwd ./bin/rmdir ./bin/sort ./etc/perms/rtsmd d*)('&%$#"!      d~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+